Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTD0CDN5)

• DOT Name: Alpha-(1,3)-fucosyltransferase 11 (FUT11)
• Synonyms: EC 2.4.1.-; Fucosyltransferase XI; Fuc-TXI; FucT-XI; Galactoside 3-L-fucosyltransferase 11; Fucosyltransferase 11
• Gene Name: FUT11
• UniProt ID: FUT11_HUMAN
• EC Number: 2.4.1.-
• Pfam ID: PF17039 ; PF00852
• Sequence:
  MAAGPIRVVLVLLGVLSVCAASGHGSVAEREAGGEAEWAEPWDGAVFRPPSALGAVGVTR
  SSGTPRPGREEAGDLPVLLWWSPGLFPHFPGDSERIECARGACVASRNRRALRDSRTRAL
  LFYGTDFRASAAPLPRLAHQSWALLHEESPLNNFLLSHGPGIRLFNLTSTFSRHSDYPLS
  LQWLPGTAYLRRPVPPPMERAEWRRRGYAPLLYLQSHCDVPADRDRYVRELMRHIPVDSY
  GKCLQNRELPTARLQDTATATTEDPELLAFLSRYKFHLALENAICNDYMTEKLWRPMHLG
  AVPVYRGSPSVRDWMPNNHSVILIDDFESPQKLAEFIDFLDKNDEEYMKYLAYKQPGGIT
  NQFLLDSLKHREWGVNDPLLPNYLNGFECFVCDYELARLDAEKAHAASPGDSPVFEPHIA
  QPSHMDCPVPTPGFGNVEEIPENDSWKEMWLQDYWQGLDQGEALTAMIHNNETEQTKFWD
  YLHEIFMKRQHL
• Function: [Isoform 1]: Has minor fucosyltransferase activity toward biantennary N-glycan acceptors. Does not fucosylate GlcNAc residue within type 2 lactosamine unit; [Isoform 2]: Has fucosyltransferase activity toward biantennary N-glycan acceptors. Does not fucosylate GlcNAc residue within type 2 lactosamine unit.
• Reactome Pathway: Lewis blood group biosynthesis (R-HSA-9037629)

Molecular Interaction Atlas (MIA) of This DOT

16 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Alpha-(1,3)-fucosyltransferase 11 (FUT11).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Alpha-(1,3)-fucosyltransferase 11 (FUT11).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Alpha-(1,3)-fucosyltransferase 11 (FUT11).	[3]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Alpha-(1,3)-fucosyltransferase 11 (FUT11).	[4]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Alpha-(1,3)-fucosyltransferase 11 (FUT11).	[5]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Alpha-(1,3)-fucosyltransferase 11 (FUT11).	[6]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Alpha-(1,3)-fucosyltransferase 11 (FUT11).	[7]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Alpha-(1,3)-fucosyltransferase 11 (FUT11).	[8]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Alpha-(1,3)-fucosyltransferase 11 (FUT11).	[9]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Alpha-(1,3)-fucosyltransferase 11 (FUT11).	[10]
Demecolcine	DMCZQGK	Approved	Demecolcine decreases the expression of Alpha-(1,3)-fucosyltransferase 11 (FUT11).	[11]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide decreases the expression of Alpha-(1,3)-fucosyltransferase 11 (FUT11).	[12]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Alpha-(1,3)-fucosyltransferase 11 (FUT11).	[13]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Alpha-(1,3)-fucosyltransferase 11 (FUT11).	[11]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Alpha-(1,3)-fucosyltransferase 11 (FUT11).	[14]
CH-223191	DMMJZYC	Investigative	CH-223191 decreases the expression of Alpha-(1,3)-fucosyltransferase 11 (FUT11).	[15]

References

• [1] Stem cell transcriptome responses and corresponding biomarkers that indicate the transition from adaptive responses to cytotoxicity. Chem Res Toxicol. 2017 Apr 17;30(4):905-922.
• [2] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [3] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [4] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [5] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [6] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [7] Gene expression profile induced by arsenic trioxide in chronic lymphocytic leukemia cells reveals a central role for heme oxygenase-1 in apoptosis and regulation of matrix metalloproteinase-9. Oncotarget. 2016 Dec 13;7(50):83359-83377.
• [8] Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
• [9] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [10] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [11] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [12] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [13] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [14] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [15] Adaptive changes in global gene expression profile of lung carcinoma A549 cells acutely exposed to distinct types of AhR ligands. Toxicol Lett. 2018 Aug;292:162-174.