Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTD943W0)

• DOT Name: Bcl-2-like protein 15 (BCL2L15)
• Synonyms: Bcl2-L-15; Bcl-2 family kin; Bfk
• Gene Name: BCL2L15
• Related Disease:
  Autoimmune thyroid disease
  Rheumatoid arthritis
  Type-1 diabetes
• UniProt ID: B2L15_HUMAN
• PDB ID: 7CCL; 7CCM
• Sequence:
  MKSSQTFEEQTECIVNTLLMDFLSPTLQVASRNLCCVDEVDSGEPCSFDVAIIAGRLRML
  GDQFNGELEASAKNVIAETIKGQTGAILQDTVESLSKTWCAQDSSLAYERAFLAVSVKLL
  EYMAHIAPEVVGQVAIPMTGMINGNQAIREFIQGQGGWENLES

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Autoimmune thyroid disease	DISIHC6A	Strong	Genetic Variation	[1]
Rheumatoid arthritis	DISTSB4J	Strong	Genetic Variation	[2]
Type-1 diabetes	DIS7HLUB	Strong	Genetic Variation	[1]

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Bcl-2-like protein 15 (BCL2L15).	[3]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of Bcl-2-like protein 15 (BCL2L15).	[4]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Bcl-2-like protein 15 (BCL2L15).	[5]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Bcl-2-like protein 15 (BCL2L15).	[6]

References

• [1] Genome wide identification of new genes and pathways in patients with both autoimmune thyroiditis and type 1 diabetes.J Autoimmun. 2015 Jun;60:32-9. doi: 10.1016/j.jaut.2015.03.006. Epub 2015 Apr 27.
• [2] REL, encoding a member of the NF-kappaB family of transcription factors, is a newly defined risk locus for rheumatoid arthritis.Nat Genet. 2009 Jul;41(7):820-3. doi: 10.1038/ng.395. Epub 2009 Jun 7.
• [3] Quercetin induced cell apoptosis and altered gene expression in AGS human gastric cancer cells. Environ Toxicol. 2018 Nov;33(11):1168-1181. doi: 10.1002/tox.22623. Epub 2018 Aug 27.
• [4] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [5] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [6] CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.