Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTDCZYFN)

• DOT Name: GA-binding protein subunit beta-2 (GABPB2)
• Synonyms: GABP subunit beta-2; GABPB-2
• Gene Name: GABPB2
• UniProt ID: GABP2_HUMAN
• Pfam ID: PF12796
• Sequence:
  MSLVDLGKRLLEAARKGQDDEVRTLMANGAPFTTDWLGTSPLHLAAQYGHYSTAEVLLRA
  GVSRDARTKVDRTPLHMAAADGHAHIVELLVRNGADVNAKDMLKMTALHWATERHHRDVV
  ELLIKYGADVHAFSKFDKSAFDIALEKNNAEILVILQEAMQNQVNVNPERANPVTDPVSM
  AAPFIFTSGEVVNLASLISSTNTKTTSGDPHASTVQFSNSTTSVLATLAALAEASVPLSN
  SHRATANTEEIIEGNSVDSSIQQVMGSGGQRVITIVTDGVPLGNIQTSIPTGGIGQPFIV
  TVQDGQQVLTVPAGKVAEETVIKEEEEEKLPLTKKPRIGEKTNSVEESKEGNERELLQQQ
  LQEANRRAQEYRHQLLKKEQEAEQYRLKLEAIARQQPNGVDFTMVEEVAEVDAVVVTEGE
  LEERETKVTGSAGTTEPHTRVSMATVSS
• Function: May function as transcription factor capable of interacting with purine rich repeats (GA repeats).

Molecular Interaction Atlas (MIA) of This DOT

13 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of GA-binding protein subunit beta-2 (GABPB2).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of GA-binding protein subunit beta-2 (GABPB2).	[2]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of GA-binding protein subunit beta-2 (GABPB2).	[3]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of GA-binding protein subunit beta-2 (GABPB2).	[4]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of GA-binding protein subunit beta-2 (GABPB2).	[5]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of GA-binding protein subunit beta-2 (GABPB2).	[6]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of GA-binding protein subunit beta-2 (GABPB2).	[7]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol decreases the expression of GA-binding protein subunit beta-2 (GABPB2).	[8]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of GA-binding protein subunit beta-2 (GABPB2).	[9]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of GA-binding protein subunit beta-2 (GABPB2).	[10]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of GA-binding protein subunit beta-2 (GABPB2).	[4]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane increases the expression of GA-binding protein subunit beta-2 (GABPB2).	[11]
chloropicrin	DMSGBQA	Investigative	chloropicrin increases the expression of GA-binding protein subunit beta-2 (GABPB2).	[12]

References

• [1] Stem cell transcriptome responses and corresponding biomarkers that indicate the transition from adaptive responses to cytotoxicity. Chem Res Toxicol. 2017 Apr 17;30(4):905-922.
• [2] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [3] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [4] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [5] Integrated assessment by multiple gene expression analysis of quercetin bioactivity on anticancer-related mechanisms in colon cancer cells in vitro. Eur J Nutr. 2005 Mar;44(3):143-56. doi: 10.1007/s00394-004-0503-1. Epub 2004 Apr 30.
• [6] Gene expression profile changes in NB4 cells induced by arsenic trioxide. Acta Pharmacol Sin. 2003 Jul;24(7):646-50.
• [7] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [8] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [9] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [10] Characterization of the Molecular Alterations Induced by the Prolonged Exposure of Normal Colon Mucosa and Colon Cancer Cells to Low-Dose Bisphenol A. Int J Mol Sci. 2022 Oct 1;23(19):11620. doi: 10.3390/ijms231911620.
• [11] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
• [12] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.