General Information of Drug Off-Target (DOT) (ID: OTDV54V6)

DOT Name Adenine nucleotide translocase lysine N-methyltransferase (ANTKMT)
Synonyms ANT-KMT; EC 2.1.1.-
Gene Name ANTKMT
Related Disease
Nasopharyngeal carcinoma ( )
UniProt ID
ANKMT_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
EC Number
2.1.1.-
Sequence
MEQDDPVEALTELRERRLGALELLQAAAGSGLAAYAVWALLLQPGFRRVPLRLQVPYVGA
SARQVEHVLSLLRGRPGKTVDLGSGDGRIVLAAHRCGLRPAVGYELNPWLVALARLHAWR
AGCAGSVCYRRKDLWKVSLRDCRNVSVFLAPSVLPLLEDKLRTELPAGARVVSGRFPLPT
WQPVTAVGEGLDRVWAYDVPEGGQAGEAASSRIPIQAAPGPSSAPIPGGLISQAS
Function
Mitochondrial protein-lysine N-methyltransferase that trimethylates adenine nucleotide translocases ANT2/SLC25A5 and ANT3/SLC25A6, thereby regulating mitochondrial respiration. Probably also trimethylates ANT1/SLC25A4.

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Nasopharyngeal carcinoma DISAOTQ0 Limited Biomarker [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Adenine nucleotide translocase lysine N-methyltransferase (ANTKMT). [2]
------------------------------------------------------------------------------------
8 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Adenine nucleotide translocase lysine N-methyltransferase (ANTKMT). [3]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Adenine nucleotide translocase lysine N-methyltransferase (ANTKMT). [4]
Methotrexate DM2TEOL Approved Methotrexate decreases the expression of Adenine nucleotide translocase lysine N-methyltransferase (ANTKMT). [5]
Menadione DMSJDTY Approved Menadione affects the expression of Adenine nucleotide translocase lysine N-methyltransferase (ANTKMT). [6]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of Adenine nucleotide translocase lysine N-methyltransferase (ANTKMT). [7]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Adenine nucleotide translocase lysine N-methyltransferase (ANTKMT). [8]
Formaldehyde DM7Q6M0 Investigative Formaldehyde decreases the expression of Adenine nucleotide translocase lysine N-methyltransferase (ANTKMT). [9]
Sulforaphane DMQY3L0 Investigative Sulforaphane decreases the expression of Adenine nucleotide translocase lysine N-methyltransferase (ANTKMT). [10]
------------------------------------------------------------------------------------
⏷ Show the Full List of 8 Drug(s)

References

1 Serum proteomics identify potential biomarkers for nasopharyngeal carcinoma sensitivity to radiotherapy.Biosci Rep. 2019 May 14;39(5):BSR20190027. doi: 10.1042/BSR20190027. Print 2019 May 31.
2 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
3 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
4 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
5 The contribution of methotrexate exposure and host factors on transcriptional variance in human liver. Toxicol Sci. 2007 Jun;97(2):582-94.
6 Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
7 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
8 Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
9 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
10 Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.