Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTDW07T3)

• DOT Name: Putative uncharacterized protein C6orf52 (C6ORF52)
• Gene Name: C6ORF52
• UniProt ID: CF052_HUMAN
• Pfam ID: PF17654
• Sequence:
  MAQPESSADFGIAQQNNYYCYWQSLPSAIRVKQEFQPSQSYRYGNWYARQHGSYLLSGYS
  YGCAVDGNGKDCFSAHETPEHTAGTLVMPKETTPLAENQDEDPLEDPHLHLNIEESNQEF
  MVKSEELYDSLMNCHWQPLDTVHSEIPDETPK

Molecular Interaction Atlas (MIA) of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Putative uncharacterized protein C6orf52 (C6ORF52).	[1]

5 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Putative uncharacterized protein C6orf52 (C6ORF52).	[2]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Putative uncharacterized protein C6orf52 (C6ORF52).	[3]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Putative uncharacterized protein C6orf52 (C6ORF52).	[4]
Indomethacin	DMSC4A7	Approved	Indomethacin increases the expression of Putative uncharacterized protein C6orf52 (C6ORF52).	[5]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Putative uncharacterized protein C6orf52 (C6ORF52).	[6]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [3] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [4] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [5] Mechanisms of indomethacin-induced alterations in the choline phospholipid metabolism of breast cancer cells. Neoplasia. 2006 Sep;8(9):758-71.
• [6] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.