Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTE8WUX6)

DOT Name 60S ribosome subunit biogenesis protein NIP7 homolog (NIP7)
Synonyms KD93; Nucleolar pre-rRNA processing protein NIP7
Gene Name NIP7
UniProt ID
NIP7_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1SQW; 1T5Y; 8FKT; 8FKU; 8FKV; 8FKW; 8FKX; 8FKY
Pfam ID
PF03657 ; PF17833
Sequence
MRPLTEEETRVMFEKIAKYIGENLQLLVDRPDGTYCFRLHNDRVYYVSEKIMKLAANISG
DKLVSLGTCFGKFTKTHKFRLHVTALDYLAPYAKYKVWIKPGAEQSFLYGNHVLKSGLGR
ITENTSQYQGVVVYSMADIPLGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRHEETLT
Function Required for proper 34S pre-rRNA processing and 60S ribosome subunit assembly.
Tissue Specificity Expressed in hematopoietic stem/progenitor cells.
Reactome Pathway
Major pathway of rRNA processing in the nucleolus and cytosol (R-HSA-6791226 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
10 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of 60S ribosome subunit biogenesis protein NIP7 homolog (NIP7). [1]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of 60S ribosome subunit biogenesis protein NIP7 homolog (NIP7). [2]
Estradiol DMUNTE3 Approved Estradiol increases the expression of 60S ribosome subunit biogenesis protein NIP7 homolog (NIP7). [3]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of 60S ribosome subunit biogenesis protein NIP7 homolog (NIP7). [4]
Temozolomide DMKECZD Approved Temozolomide increases the expression of 60S ribosome subunit biogenesis protein NIP7 homolog (NIP7). [5]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide affects the expression of 60S ribosome subunit biogenesis protein NIP7 homolog (NIP7). [6]
Phenobarbital DMXZOCG Approved Phenobarbital affects the expression of 60S ribosome subunit biogenesis protein NIP7 homolog (NIP7). [7]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of 60S ribosome subunit biogenesis protein NIP7 homolog (NIP7). [8]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of 60S ribosome subunit biogenesis protein NIP7 homolog (NIP7). [9]
Trichostatin A DM9C8NX Investigative Trichostatin A affects the expression of 60S ribosome subunit biogenesis protein NIP7 homolog (NIP7). [10]
------------------------------------------------------------------------------------
⏷ Show the Full List of 10 Drug(s)

References

1 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
2 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
3 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
4 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
5 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
6 Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
7 Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
8 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
9 Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
10 A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.