Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTECPJJ0)

• DOT Name: Ferredoxin-fold anticodon-binding domain-containing protein 1 (FDXACB1)
• Synonyms: FDX-ACDB domain-containing protein 1
• Gene Name: FDXACB1
• UniProt ID: FDXA1_HUMAN
• Pfam ID: PF10354 ; PF03147
• Sequence:
  MAPRRLLLVGEGNFSFAAALSETLDQSTQLTATCLQRPAELARDPLAWENLQCLRERGID
  VRFGVDCTQLADVFELHEREFDQIYFIFPHCGRKAGVAKNRELLAKFFQSCADVLAEEGE
  VHVALCRGQGGTPADKPQREWHNSWQVVAMAALGGLILSDVYPFSCKAVAGYKCTGYRSQ
  DKSFHVEGALNHIFTRSLPFEGSQPRIFRIKLGNQWFSFPEPEALVGKLNRGFLEAPSCH
  PIKTINEKLIAELGKVFPLKRLKCSYPLLPQEGTSVLPFWNCDFLSAAFWISLHEDNSNS
  ESLTGGTSQDVEDFLVSFSELSLLKNPGRDGKEEACEGTCGQAKICLRPSLLVHVQDVIE
  VPDFLSGSLHILSGPVFQKCHILPFTMPAFHETLFILGVNQNLKDGCLQSLLDHLKGILD
  SLLTQTLPESSKLSSLVKFVLQSNGKDYMIRVKTHNFSPDCTEDLIIGSVITSATSVIHK
  DQCFVFVSMNLDLLAMLVWCISDWRMLWTFDNRFLKNFVPGKIEPFKSHSLYPPCYVHDV
  SFWIDQKKGFDELEFHTVARAVSQDTIISIQFLSRFQHPKTQQVSLCYRLTYQTCDKALT
  QQQVASMQSQFRKEIQQHLYVIPR

Molecular Interaction Atlas (MIA) of This DOT

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Ferredoxin-fold anticodon-binding domain-containing protein 1 (FDXACB1).	[1]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Ferredoxin-fold anticodon-binding domain-containing protein 1 (FDXACB1).	[2]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Ferredoxin-fold anticodon-binding domain-containing protein 1 (FDXACB1).	[3]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Ferredoxin-fold anticodon-binding domain-containing protein 1 (FDXACB1).	[4]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Ferredoxin-fold anticodon-binding domain-containing protein 1 (FDXACB1).	[5]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Ferredoxin-fold anticodon-binding domain-containing protein 1 (FDXACB1).	[7]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Ferredoxin-fold anticodon-binding domain-containing protein 1 (FDXACB1).	[8]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Ferredoxin-fold anticodon-binding domain-containing protein 1 (FDXACB1).	[9]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Ferredoxin-fold anticodon-binding domain-containing protein 1 (FDXACB1).	[6]

References

• [1] Stem cell transcriptome responses and corresponding biomarkers that indicate the transition from adaptive responses to cytotoxicity. Chem Res Toxicol. 2017 Apr 17;30(4):905-922.
• [2] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [3] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [4] Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
• [5] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [6] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [7] Targeting MYCN in neuroblastoma by BET bromodomain inhibition. Cancer Discov. 2013 Mar;3(3):308-23.
• [8] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [9] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.