Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTEP5XE8)

DOT Name Uncharacterized protein NKAPD1 (NKAPD1)
Synonyms NKAP domain containing protein 1
Gene Name NKAPD1
UniProt ID
NKAP1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF15692
Sequence
MSRIPLGKVLLRNVIRHTDAHNKIQEESDMWKIRELEKQMEDAYRGTKRKMLPSSSSRMR
SDGFDEESQRYYWRPKNEISGTLEDDFLKAKSWNKKFYDYEANMPDRWGHSGYKELYPEE
FETDSDQQDITNGKKTSPQVKSSTHESRKHKKSKKSHKKKQKKRSHKKQKKSKKEATDIT
ADSSSEFSEETGASGTRKGKQPHKRKKKSRKKSLKKPALFLEAESNTSHSDDSASSSSEE
SEERDTKKTKRKKREKKAHTSVANNEIQERTNKRTNWKVATDERSAESSEDD

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
8 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Uncharacterized protein NKAPD1 (NKAPD1). [1]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Uncharacterized protein NKAPD1 (NKAPD1). [2]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide affects the expression of Uncharacterized protein NKAPD1 (NKAPD1). [3]
Vorinostat DMWMPD4 Approved Vorinostat decreases the expression of Uncharacterized protein NKAPD1 (NKAPD1). [4]
PMID28870136-Compound-48 DMPIM9L Patented PMID28870136-Compound-48 increases the expression of Uncharacterized protein NKAPD1 (NKAPD1). [5]
Trichostatin A DM9C8NX Investigative Trichostatin A decreases the expression of Uncharacterized protein NKAPD1 (NKAPD1). [6]
Formaldehyde DM7Q6M0 Investigative Formaldehyde decreases the expression of Uncharacterized protein NKAPD1 (NKAPD1). [7]
GALLICACID DM6Y3A0 Investigative GALLICACID increases the expression of Uncharacterized protein NKAPD1 (NKAPD1). [8]
------------------------------------------------------------------------------------
⏷ Show the Full List of 8 Drug(s)

References

1 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
2 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
3 Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
4 Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
5 Oxidative stress modulates theophylline effects on steroid responsiveness. Biochem Biophys Res Commun. 2008 Dec 19;377(3):797-802.
6 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
7 Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.
8 Gene expression profile analysis of gallic acid-induced cell death process. Sci Rep. 2021 Aug 18;11(1):16743. doi: 10.1038/s41598-021-96174-1.