General Information of Drug Off-Target (DOT) (ID: OTEYPTJP)

DOT Name Cytochrome c oxidase assembly protein COX16 homolog, mitochondrial (COX16)
Synonyms hCOX16
Gene Name COX16
Related Disease
Cytochrome-c oxidase deficiency disease ( )
Renal tubular acidosis ( )
Mitochondrial complex IV deficiency, nuclear type 22 ( )
UniProt ID
COX16_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF14138
Sequence
MFAPAVMRAFRKNKTLGYGVPMLLLIVGGSFGLREFSQIRYDAVKSKMDPELEKKLKENK
ISLESEYEKIKDSKFDDWKNIRGPRPWEDPDLLQGRNPESLKTKTT
Function
Required for the assembly of the mitochondrial respiratory chain complex IV (CIV), also known as cytochrome c oxidase. Promotes the insertion of copper into the active site of cytochrome c oxidase subunit II (MT-CO2/COX2). Interacts specifically with newly synthesized MT-CO2/COX and its copper center-forming metallochaperones SCO1, SCO2 and COA6. Probably facilitates MT-CO2/COX2 association with the MITRAC assembly intermediate containing MT-CO1/COX1, thereby participating in merging the MT-CO1/COX1 and MT-CO2/COX2 assembly lines.
Tissue Specificity Widely expressed. Expressed at higher level in skeletal muscle, heart and liver.
KEGG Pathway
Thermogenesis (hsa04714 )
Reactome Pathway
Respiratory electron transport (R-HSA-611105 )
Cytoprotection by HMOX1 (R-HSA-9707564 )
TP53 Regulates Metabolic Genes (R-HSA-5628897 )

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Cytochrome-c oxidase deficiency disease DISK7N3G Strong Genetic Variation [1]
Renal tubular acidosis DISE1NDR Strong Genetic Variation [2]
Mitochondrial complex IV deficiency, nuclear type 22 DISEYURW Limited Autosomal recessive [3]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
7 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Cytochrome c oxidase assembly protein COX16 homolog, mitochondrial (COX16). [4]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Cytochrome c oxidase assembly protein COX16 homolog, mitochondrial (COX16). [5]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Cytochrome c oxidase assembly protein COX16 homolog, mitochondrial (COX16). [6]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Cytochrome c oxidase assembly protein COX16 homolog, mitochondrial (COX16). [7]
Vorinostat DMWMPD4 Approved Vorinostat increases the expression of Cytochrome c oxidase assembly protein COX16 homolog, mitochondrial (COX16). [8]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Cytochrome c oxidase assembly protein COX16 homolog, mitochondrial (COX16). [10]
chloropicrin DMSGBQA Investigative chloropicrin increases the expression of Cytochrome c oxidase assembly protein COX16 homolog, mitochondrial (COX16). [11]
------------------------------------------------------------------------------------
⏷ Show the Full List of 7 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of Cytochrome c oxidase assembly protein COX16 homolog, mitochondrial (COX16). [9]
------------------------------------------------------------------------------------

References

1 Studies of COX16, COX19, and PET191 in human cytochrome-c oxidase deficiency.Arch Neurol. 2004 Dec;61(12):1935-7. doi: 10.1001/archneur.61.12.1935.
2 Sideroblastic anemia associated with multisystem mitochondrial disorders.Pediatr Blood Cancer. 2019 Apr;66(4):e27591. doi: 10.1002/pbc.27591. Epub 2018 Dec 26.
3 A novel variant in COX16 causes cytochrome c oxidase deficiency, severe fatal neonatal lactic acidosis, encephalopathy, cardiomyopathy, and liver dysfunction. Hum Mutat. 2021 Feb;42(2):135-141. doi: 10.1002/humu.24137. Epub 2020 Nov 30.
4 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
5 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
6 Human 3D multicellular microtissues: an upgraded model for the in vitro mechanistic investigation of inflammation-associated drug toxicity. Toxicol Lett. 2019 Sep 15;312:34-44.
7 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
8 Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
9 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
10 Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
11 Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.