Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTF2E8M6)

DOT Name	Protein ABHD13 (ABHD13)
Synonyms	EC 3.-.-.-; Alpha/beta hydrolase domain-containing protein 13; Abhydrolase domain-containing protein 13
Gene Name	ABHD13
UniProt ID	ABHDD_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
EC Number	3.-.-.-
Pfam ID	PF00561
Sequence	MEKSWMLWNFVERWLIALASWSWALCRISLLPLIVTFHLYGGIILLLLIFISIAGILYKF QDVLLYFPEQPSSSRLYVPMPTGIPHENIFIRTKDGIRLNLILIRYTGDNSPYSPTIIYF HGNAGNIGHRLPNALLMLVNLKVNLLLVDYRGYGKSEGEASEEGLYLDSEAVLDYVMTRP DLDKTKIFLFGRSLGGAVAIHLASENSHRISAIMVENTFLSIPHMASTLFSFFPMRYLPL WCYKNKFLSYRKISQCRMPSLFISGLSDQLIPPVMMKQLYELSPSRTKRLAIFPDGTHND TWQCQGYFTALEQFIKEVVKSHSPEEMAKTSSNVTII

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

7 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Protein ABHD13 (ABHD13).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Protein ABHD13 (ABHD13).	[2]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Protein ABHD13 (ABHD13).	[3]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Protein ABHD13 (ABHD13).	[4]
Folic acid	DMEMBJC	Approved	Folic acid decreases the expression of Protein ABHD13 (ABHD13).	[5]
Irinotecan	DMP6SC2	Approved	Irinotecan decreases the expression of Protein ABHD13 (ABHD13).	[6]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Protein ABHD13 (ABHD13).	[7]
------------------------------------------------------------------------------------


⏷ Show the Full List of 7 Drug(s)

References

1	Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
2	Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
3	Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
4	Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
5	Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
6	Clinical determinants of response to irinotecan-based therapy derived from cell line models. Clin Cancer Res. 2008 Oct 15;14(20):6647-55.
7	A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.