Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTFCPUMK)

• DOT Name: Serine/arginine-rich splicing factor 12 (SRSF12)
• Synonyms: 35 kDa SR repressor protein; SRrp35; Splicing factor, arginine/serine-rich 13B; Splicing factor, arginine/serine-rich 19
• Gene Name: SRSF12
• UniProt ID: SRS12_HUMAN
• Pfam ID: PF00076
• Sequence:
  MSRYTRPPNTSLFIRNVADATRPEDLRREFGRYGPIVDVYIPLDFYTRRPRGFAYVQFED
  VRDAEDALYNLNRKWVCGRQIEIQFAQGDRKTPGQMKSKERHPCSPSDHRRSRSPSQRRT
  RSRSSSWGRNRRRSDSLKESRHRRFSYSQSKSRSKSLPRRSTSARQSRTPRRNFGSRGRS
  RSKSLQKRSKSIGKSQSSSPQKQTSSGTKSRSHGRHSDSIARSPCKSPKGYTNSETKVQT
  AKHSHFRSHSRSRSYRHKNSW
• Function: Splicing factor that seems to antagonize SR proteins in pre-mRNA splicing regulation.
• Tissue Specificity: Expressed in testis.
• Reactome Pathway:
  Processing of Capped Intron-Containing Pre-mRNA (R-HSA-72203)
  mRNA Splicing - Major Pathway (R-HSA-72163)

Molecular Interaction Atlas (MIA) of This DOT

6 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Serine/arginine-rich splicing factor 12 (SRSF12).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Serine/arginine-rich splicing factor 12 (SRSF12).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Serine/arginine-rich splicing factor 12 (SRSF12).	[3]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Serine/arginine-rich splicing factor 12 (SRSF12).	[4]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Serine/arginine-rich splicing factor 12 (SRSF12).	[5]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Serine/arginine-rich splicing factor 12 (SRSF12).	[7]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Serine/arginine-rich splicing factor 12 (SRSF12).	[6]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [3] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [4] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [5] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [6] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [7] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.