Details of Drug Off-Target (DOT)
General Information of Drug Off-Target (DOT) (ID: OTG192UT)
| DOT Name | Solute carrier family 22 member 16 (SLC22A16) | ||||
|---|---|---|---|---|---|
| Synonyms | Carnitine transporter 2; CT2; Fly-like putative transporter 2; FLIPT2; Flipt 2; Organic cation transporter OKB1; Organic cation/carnitine transporter 6 | ||||
| Gene Name | SLC22A16 | ||||
| UniProt ID | |||||
| 3D Structure | |||||
| Pfam ID | |||||
| Sequence |
MGSRHFEGIYDHVGHFGRFQRVLYFICAFQNISCGIHYLASVFMGVTPHHVCRPPGNVSQ
VVFHNHSNWSLEDTGALLSSGQKDYVTVQLQNGEIWELSRCSRNKRENTSSLGYEYTGSK KEFPCVDGYIYDQNTWKSTAVTQWNLVCDRKWLAMLIQPLFMFGVLLGSVTFGYFSDRLG RRVVLWATSSSMFLFGIAAAFAVDYYTFMAARFFLAMVASGYLVVGFVYVMEFIGMKSRT WASVHLHSFFAVGTLLVALTGYLVRTWWLYQMILSTVTVPFILCCWVLPETPFWLLSEGR YEEAQKIVDIMAKWNRASSCKLSELLSLDLQGPVSNSPTEVQKHNLSYLFYNWSITKRTL TVWLIWFTGSLGFYSFSLNSVNLGGNEYLNLFLLGVVEIPAYTFVCIAMDKVGRRTVLAY SLFCSALACGVVMVIPQKHYILGVVTAMVGKFAIGAAFGLIYLYTAELYPTIVRSLAVGS GSMVCRLASILAPFSVDLSSIWIFIPQLFVGTMALLSGVLTLKLPETLGKRLATTWEEAA KLESENESKSSKLLLTTNNSGLEKTEAITPRDSGLGE |
||||
| Function |
Facilitative organic cation transporter that mediates the transport of carnitine as well as the polyamine spermidine. Mediates the partially Na(+)-dependent bidirectional transport of carnitine. May mediate L-carnitine secretion from testis epididymal epithelium into the lumen which is involved in the maturation of spermatozoa.
|
||||
| Tissue Specificity |
Expressed in testis and epididymis (at protein level) . Expressed in endometrium (at protein level); highly expressed during the normal secretory phase, but expression is significantly reduced in the proliferative phase . Expressed at lower levels in adult tissues including bone marrow (at protein level) . Expressed in hematopoietic cells, including CD34(+) leukocytes . Expressed in fetal liver (at protein level), brain, lung, kidney, heart, skeletal muscle, spleen and thymus . Expressed in leukemia cells . Abundantly expressed in ovarian cancer clear-cell adenocarcinoma .
|
||||
| Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DOT
| Molecular Interaction Atlas (MIA) | |||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
This DOT Affected the Regulation of Drug Effects of 2 Drug(s)
|
|||||||||||||||||||||||||||||||||||
|
3 Drug(s) Affected the Gene/Protein Processing of This DOT
|
|||||||||||||||||||||||||||||||||||
|
1 Drug(s) Affected the Post-Translational Modifications of This DOT
|
|||||||||||||||||||||||||||||||||||
References
