General Information of Drug Off-Target (DOT) (ID: OTGS3H0M)

DOT Name G-patch domain and KOW motifs-containing protein (GPKOW)
Synonyms G-patch domain-containing protein 5; Protein MOS2 homolog; Protein T54
Gene Name GPKOW
Related Disease
Advanced cancer ( )
Atypical teratoid/rhabdoid tumour ( )
Depression ( )
Fetal growth restriction ( )
Isolated congenital microcephaly ( )
Neoplasm ( )
Non-small-cell lung cancer ( )
Holoprosencephaly-hypokinesia-congenital contractures syndrome ( )
UniProt ID
GPKOW_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
7DVQ; 7QTT; 8CH6
Pfam ID
PF12656 ; PF00467
Sequence
MADSKEGVLPLTAASTAPISFGFTRTSARRRLADSGDGAGPSPEEKDFLKTVEGRELQSV
KPQEAPKELVIPLIQNGHRRQPPARPPGPSTDTGALADGVVSQAVKELIAESKKSLEERE
NAGVDPTLAIPMIQKGCTPSGEGADSEPRAETVPEEANYEAVPVEAYGLAMLRGMGWKPG
EGIGRTFNQVVKPRVNSLRPKGLGLGANLTEAQALTPTGPSRMPRPDEEQEKDKEDQPQG
LVPGGAVVVLSGPHRGLYGKVEGLDPDNVRAMVRLAVGSRVVTVSEYYLRPVSQQEFDKN
TLDLRQQNGTASSRKTLWNQELYIQQDNSERKRKHLPDRQDGPAAKSEKAAPRSQHWLHR
DLRVRFVDNMYKGGQYYNTKMIIEDVLSPDTCVCRTDEGRVLEGLREDMLETLVPKAEGD
RVMVVLGPQTGRVGHLLSRDRARSRALVQLPRENQVVELHYDAICQYMGPSDTDDD
Function RNA-binding protein involved in pre-mRNA splicing. As a component of the minor spliceosome, involved in the splicing of U12-type introns in pre-mRNAs (Probable).
Reactome Pathway
mRNA Splicing - Major Pathway (R-HSA-72163 )

Molecular Interaction Atlas (MIA) of This DOT

8 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Advanced cancer DISAT1Z9 Strong Biomarker [1]
Atypical teratoid/rhabdoid tumour DIS1FA0D Strong Biomarker [2]
Depression DIS3XJ69 Strong Biomarker [3]
Fetal growth restriction DIS5WEJ5 Strong Biomarker [4]
Isolated congenital microcephaly DISUXHZ6 Strong Biomarker [4]
Neoplasm DISZKGEW Strong Biomarker [5]
Non-small-cell lung cancer DIS5Y6R9 Strong Biomarker [6]
Holoprosencephaly-hypokinesia-congenital contractures syndrome DISZGEKL Limited X-linked [7]
------------------------------------------------------------------------------------
⏷ Show the Full List of 8 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
9 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate affects the expression of G-patch domain and KOW motifs-containing protein (GPKOW). [8]
Doxorubicin DMVP5YE Approved Doxorubicin increases the expression of G-patch domain and KOW motifs-containing protein (GPKOW). [9]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of G-patch domain and KOW motifs-containing protein (GPKOW). [10]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide affects the expression of G-patch domain and KOW motifs-containing protein (GPKOW). [13]
Selenium DM25CGV Approved Selenium increases the expression of G-patch domain and KOW motifs-containing protein (GPKOW). [14]
Azacitidine DMTA5OE Approved Azacitidine increases the expression of G-patch domain and KOW motifs-containing protein (GPKOW). [15]
Tocopherol DMBIJZ6 Phase 2 Tocopherol increases the expression of G-patch domain and KOW motifs-containing protein (GPKOW). [14]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 decreases the expression of G-patch domain and KOW motifs-containing protein (GPKOW). [17]
Milchsaure DM462BT Investigative Milchsaure decreases the expression of G-patch domain and KOW motifs-containing protein (GPKOW). [18]
------------------------------------------------------------------------------------
⏷ Show the Full List of 9 Drug(s)
4 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Arsenic DMTL2Y1 Approved Arsenic affects the methylation of G-patch domain and KOW motifs-containing protein (GPKOW). [11]
Quercetin DM3NC4M Approved Quercetin decreases the phosphorylation of G-patch domain and KOW motifs-containing protein (GPKOW). [12]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of G-patch domain and KOW motifs-containing protein (GPKOW). [16]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 affects the phosphorylation of G-patch domain and KOW motifs-containing protein (GPKOW). [12]
------------------------------------------------------------------------------------

References

1 Nanoceria decorated flower-like molybdenum sulphide nanoflakes: an efficient nanozyme for tumour selective ROS generation and photo thermal therapy.Chem Commun (Camb). 2019 Jul 4;55(55):8017-8020. doi: 10.1039/c9cc03763b.
2 Controllable synthesis of MoS(2)@MoO(2) nanonetworks for enhanced NO(2) room temperature sensing in air.Nanoscale. 2019 Apr 25;11(17):8554-8564. doi: 10.1039/c9nr00137a.
3 2D electric-double-layer phototransistor for photoelectronic and spatiotemporal hybrid neuromorphic integration.Nanoscale. 2019 Jan 17;11(3):1360-1369. doi: 10.1039/c8nr07133k.
4 Variant in the X-chromosome spliceosomal gene GPKOW causes male-lethal microcephaly with intrauterine growth restriction.Eur J Hum Genet. 2017 Sep;25(9):1078-1082. doi: 10.1038/ejhg.2017.97. Epub 2017 Jun 14.
5 Bottom-up synthesis of MoS(2) nanospheres for photothermal treatment of tumors.Photochem Photobiol Sci. 2018 Oct 10;17(10):1337-1345. doi: 10.1039/c8pp00198g.
6 Peritoneal carcinomatosis in non-small-cell lung cancer: retrospective multicentric analysis and literature review.Future Oncol. 2019 Mar;15(9):989-994. doi: 10.2217/fon-2018-0469. Epub 2019 Jan 25.
7 Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
8 Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
9 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
10 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
11 Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
12 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
13 Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
14 Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
15 The effect of DNA methylation inhibitor 5-Aza-2'-deoxycytidine on human endometrial stromal cells. Hum Reprod. 2010 Nov;25(11):2859-69.
16 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
17 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
18 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.