Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTH9EUZT)

• DOT Name: Putative deoxyribonuclease TATDN3 (TATDN3)
• Synonyms: EC 3.1.21.-
• Gene Name: TATDN3
• UniProt ID: TATD3_HUMAN
• PDB ID: 2Y1H
• EC Number: 3.1.21.-
• Pfam ID: PF01026
• Sequence:
  MRAAGVGLVDCHCHLSAPDFDRDLDDVLEKAKKANVVALVAVAEHSGEFEKIMQLSERYN
  GFVLPCLGVHPVQGLPPEDQRSVTLKDLDVALPIIENYKDRLLAIGEVGLDFSPRFAGTG
  EQKEEQRQVLIRQIQLAKRLNLPVNVHSRSAGRPTINLLQEQGAEKVLLHAFDGRPSVAM
  EGVRAGYFFSIPPSIIRSGQKQKLVKQLPLTSICLETDSPALGPEKQVRNEPWNISISAE
  YIAQVKGISVEEVIEVTTQNALKLFPKLRHLLQK
• Function: Putative deoxyribonuclease.

Molecular Interaction Atlas (MIA) of This DOT

10 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Putative deoxyribonuclease TATDN3 (TATDN3).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Putative deoxyribonuclease TATDN3 (TATDN3).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Putative deoxyribonuclease TATDN3 (TATDN3).	[3]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Putative deoxyribonuclease TATDN3 (TATDN3).	[4]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Putative deoxyribonuclease TATDN3 (TATDN3).	[5]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Putative deoxyribonuclease TATDN3 (TATDN3).	[6]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Putative deoxyribonuclease TATDN3 (TATDN3).	[7]
Testosterone	DM7HUNW	Approved	Testosterone increases the expression of Putative deoxyribonuclease TATDN3 (TATDN3).	[8]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Putative deoxyribonuclease TATDN3 (TATDN3).	[10]
Resorcinol	DMM37C0	Investigative	Resorcinol decreases the expression of Putative deoxyribonuclease TATDN3 (TATDN3).	[11]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Putative deoxyribonuclease TATDN3 (TATDN3).	[9]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [3] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [4] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [5] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [6] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [7] High-throughput ectopic expression screen for tamoxifen resistance identifies an atypical kinase that blocks autophagy. Proc Natl Acad Sci U S A. 2011 Feb 1;108(5):2058-63.
• [8] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [9] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [10] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [11] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.