Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTHBKTIU)

• DOT Name: Tetratricopeptide repeat protein 9B (TTC9B)
• Synonyms: TPR repeat protein 9B
• Gene Name: TTC9B
• Related Disease:
  Postpartum depression
  Progressive pseudorheumatoid arthropathy of childhood
• UniProt ID: TTC9B_HUMAN
• Pfam ID: PF07719
• Sequence:
  MQRGALSPVLMLSAAPEPPPRPPPALSPPGSGPGSGSRHGSARPGPTPEPSGSLGAALDS
  SLRAAVAFKAEGQRCYREKKFREAIGKYHRALLQLKAAQGARPSGLPAPAPGPTSSPGPA
  RLSEEQRRLVESTEVECYDSLTACLLQSELVNYERVREYCLKVLEKQQGNFKATYRAGIA
  FYHLGDYARALRYLQEARSREPTDTNVLRYIQLTQLKMNRCSLQREDSGAGSQTRDVIG

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Postpartum depression	DIS08UKE	Strong	Posttranslational Modification	[1]
Progressive pseudorheumatoid arthropathy of childhood	DISBMRIW	Limited	Altered Expression	[2]

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Tetratricopeptide repeat protein 9B (TTC9B).	[3]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Tetratricopeptide repeat protein 9B (TTC9B).	[4]
Niclosamide	DMJAGXQ	Approved	Niclosamide increases the expression of Tetratricopeptide repeat protein 9B (TTC9B).	[5]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of Tetratricopeptide repeat protein 9B (TTC9B).	[7]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Tetratricopeptide repeat protein 9B (TTC9B).	[6]

References

• [1] DNA methylation biomarkers prospectively predict both antenatal and postpartum depression.Psychiatry Res. 2020 Mar;285:112711. doi: 10.1016/j.psychres.2019.112711. Epub 2019 Nov 27.
• [2] Replication of Epigenetic Postpartum Depression Biomarkers and Variation with Hormone Levels.Neuropsychopharmacology. 2016 May;41(6):1648-58. doi: 10.1038/npp.2015.333. Epub 2015 Oct 27.
• [3] Stem cell transcriptome responses and corresponding biomarkers that indicate the transition from adaptive responses to cytotoxicity. Chem Res Toxicol. 2017 Apr 17;30(4):905-922.
• [4] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [5] Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
• [6] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [7] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.