Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTHMMYD5)

• DOT Name: Protein NipSnap homolog 3B (NIPSNAP3B)
• Synonyms: NipSnap3B; SNAP1
• Gene Name: NIPSNAP3B
• Related Disease:
  Spondylocarpotarsal synostosis syndrome
  Advanced cancer
• UniProt ID: NPS3B_HUMAN
• Pfam ID: PF07978
• Sequence:
  MLVLRSGLTKALASRTLAPQVCSSFATGPRQYDGTFYEFRTYYLKPSNMNAFMENLKKNI
  HLRTSYSELVGFWSVEFGGRTNKVFHIWKYDNFAHRAEVRKALANCKEWQEQSIIPNLAR
  IDKQETEITYLIPWSKLEKPPKEGVYELAVFQMKPGGPALWGDAFERAINAHVNLGYTKV
  VGVFHTEYGELNRVHVLWWNESADSRAAGRHKSHEDPRVVAAVRESVNYLVSQQNMLLIP
  ASFSPLK

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Spondylocarpotarsal synostosis syndrome	DISF9VP3	Strong	Biomarker	[1]
Advanced cancer	DISAT1Z9	moderate	Altered Expression	[2]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Protein NipSnap homolog 3B (NIPSNAP3B).	[3]
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Protein NipSnap homolog 3B (NIPSNAP3B).	[7]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Protein NipSnap homolog 3B (NIPSNAP3B).	[9]

5 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Protein NipSnap homolog 3B (NIPSNAP3B).	[4]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Protein NipSnap homolog 3B (NIPSNAP3B).	[5]
Estradiol	DMUNTE3	Approved	Estradiol affects the expression of Protein NipSnap homolog 3B (NIPSNAP3B).	[6]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol decreases the expression of Protein NipSnap homolog 3B (NIPSNAP3B).	[8]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Protein NipSnap homolog 3B (NIPSNAP3B).	[10]

References

• [1] Gene-level association analysis of systemic sclerosis: A comparison of African-Americans and White populations.PLoS One. 2018 Jan 2;13(1):e0189498. doi: 10.1371/journal.pone.0189498. eCollection 2018.
• [2] The actin-sequestering protein thymosin beta-4 is a novel target of hypoxia-inducible nitric oxide and HIF-1 regulation.PLoS One. 2014 Oct 1;9(10):e106532. doi: 10.1371/journal.pone.0106532. eCollection 2014.
• [3] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [4] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [5] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [6] Identification of novel low-dose bisphenol a targets in human foreskin fibroblast cells derived from hypospadias patients. PLoS One. 2012;7(5):e36711. doi: 10.1371/journal.pone.0036711. Epub 2012 May 4.
• [7] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [8] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [9] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [10] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.