Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTI2QPM2)

DOT Name Leucine-rich repeat and fibronectin type-III domain-containing protein 2 (LRFN2)
Synonyms Synaptic adhesion-like molecule 1
Gene Name LRFN2
Related Disease
Autism ( )
Esophageal squamous cell carcinoma ( )
Lung carcinoma ( )
Non-insulin dependent diabetes ( )
Schizophrenia ( )
Squamous cell carcinoma ( )
Stomach cancer ( )
UniProt ID
LRFN2_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00041 ; PF07679 ; PF13855
Sequence
METLLGGLLAFGMAFAVVDACPKYCVCQNLSESLGTLCPSKGLLFVPPDIDRRTVELRLG
GNFIIHISRQDFANMTGLVDLTLSRNTISHIQPFSFLDLESLRSLHLDSNRLPSLGEDTL
RGLVNLQHLIVNNNQLGGIADEAFEDFLLTLEDLDLSYNNLHGLPWDSVRRMVNLHQLSL
DHNLLDHIAEGTFADLQKLARLDLTSNRLQKLPPDPIFARSQASALTATPFAPPLSFSFG
GNPLHCNCELLWLRRLERDDDLETCGSPGGLKGRYFWHVREEEFVCEPPLITQHTHKLLV
LEGQAATLKCKAIGDPSPLIHWVAPDDRLVGNSSRTAVYDNGTLDIFITTSQDSGAFTCI
AANAAGEATAMVEVSIVQLPHLSNSTSRTAPPKSRLSDITGSSKTSRGGGGSGGGEPPKS
PPERAVLVSEVTTTSALVKWSVSKSAPRVKMYQLQYNCSDDEVLIYRMIPASNKAFVVNN
LVSGTGYDLCVLAMWDDTATTLTATNIVGCAQFFTKADYPQCQSMHSQILGGTMILVIGG
IIVATLLVFIVILMVRYKVCNHEAPSKMAAAVSNVYSQTNGAQPPPPSSAPAGAPPQGPP
KVVVRNELLDFTASLARASDSSSSSSLGSGEAAGLGRAPWRIPPSAPRPKPSLDRLMGAF
ASLDLKSQRKEELLDSRTPAGRGAGTSARGHHSDREPLLGPPAARARSLLPLPLEGKAKR
SHSFDMGDFAAAAAGGVVPGGYSPPRKVSNIWTKRSLSVNGMLLPFEESDLVGARGTFGS
SEWVMESTV
Function Promotes neurite outgrowth in hippocampal neurons. Enhances the cell surface expression of 2 NMDA receptor subunits GRIN1 and GRIN2A. May play a role in redistributing DLG4 to the cell periphery.
Reactome Pathway
Synaptic adhesion-like molecules (R-HSA-8849932 )

Molecular Interaction Atlas (MIA) of This DOT

7 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Autism DISV4V1Z Strong Genetic Variation [1]
Esophageal squamous cell carcinoma DIS5N2GV Strong Genetic Variation [2]
Lung carcinoma DISTR26C Strong Genetic Variation [3]
Non-insulin dependent diabetes DISK1O5Z Strong Genetic Variation [4]
Schizophrenia DISSRV2N Strong Genetic Variation [1]
Squamous cell carcinoma DISQVIFL Strong Genetic Variation [3]
Stomach cancer DISKIJSX Strong Genetic Variation [3]
------------------------------------------------------------------------------------
⏷ Show the Full List of 7 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
4 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Leucine-rich repeat and fibronectin type-III domain-containing protein 2 (LRFN2). [5]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of Leucine-rich repeat and fibronectin type-III domain-containing protein 2 (LRFN2). [6]
Calcitriol DM8ZVJ7 Approved Calcitriol decreases the expression of Leucine-rich repeat and fibronectin type-III domain-containing protein 2 (LRFN2). [7]
Testosterone DM7HUNW Approved Testosterone decreases the expression of Leucine-rich repeat and fibronectin type-III domain-containing protein 2 (LRFN2). [7]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of Leucine-rich repeat and fibronectin type-III domain-containing protein 2 (LRFN2). [8]
------------------------------------------------------------------------------------

References

1 Autism-like behaviours and enhanced memory formation and synaptic plasticity in Lrfn2/SALM1-deficient mice.Nat Commun. 2017 Jun 12;8:15800. doi: 10.1038/ncomms15800.
2 Intronic polymorphisms in genes LRFN2 (rs2494938) and DNAH11 (rs2285947) are prognostic indicators of esophageal squamous cell carcinoma.BMC Med Genet. 2019 May 3;20(1):72. doi: 10.1186/s12881-019-0796-9.
3 Genetic variants at 6p21.1 and 7p15.3 are associated with risk of multiple cancers in Han Chinese.Am J Hum Genet. 2012 Nov 2;91(5):928-34. doi: 10.1016/j.ajhg.2012.09.009. Epub 2012 Oct 25.
4 Genetic Variants in HSD17B3, SMAD3, and IPO11 Impact Circulating Lipids in Response to Fenofibrate in Individuals With Type 2 Diabetes.Clin Pharmacol Ther. 2018 Apr;103(4):712-721. doi: 10.1002/cpt.798. Epub 2017 Nov 3.
5 Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
6 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
7 Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
8 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.