General Information of Drug Off-Target (DOT) (ID: OTI8S0O2)

DOT Name Melanoma-associated antigen 6 (MAGEA6)
Synonyms Cancer/testis antigen 1.6; CT1.6; MAGE-6 antigen; MAGE3B antigen
Gene Name MAGEA6
UniProt ID
MAGA6_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF01454 ; PF12440
Sequence
MPLEQRSQHCKPEEGLEARGEALGLVGAQAPATEEQEAASSSSTLVEVTLGEVPAAESPD
PPQSPQGASSLPTTMNYPLWSQSYEDSSNQEEEGPSTFPDLESEFQAALSRKVAKLVHFL
LLKYRAREPVTKAEMLGSVVGNWQYFFPVIFSKASDSLQLVFGIELMEVDPIGHVYIFAT
CLGLSYDGLLGDNQIMPKTGFLIIILAIIAKEGDCAPEEKIWEELSVLEVFEGREDSIFG
DPKKLLTQYFVQENYLEYRQVPGSDPACYEFLWGPRALIETSYVKVLHHMVKISGGPRIS
YPLLHEWALREGEE
Function
Activator of ubiquitin ligase activity of RING-type zinc finger-containing E3 ubiquitin-protein ligases that acts as a repressor of autophagy. May enhance ubiquitin ligase activity of TRIM28 and stimulate p53/TP53 ubiquitination by TRIM28. Proposed to act through recruitment and/or stabilization of the Ubl-conjugating enzyme (E2) at the E3:substrate complex. May play a role in tumor transformation or aspects of tumor progression. In vitro promotes cell viability in melanoma cell lines.
Tissue Specificity Expressed in many tumors of several types, such as melanoma, head and neck squamous cell carcinoma, lung carcinoma and breast carcinoma, but not in normal tissues except for testes.

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 4 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Methotrexate DM2TEOL Approved Melanoma-associated antigen 6 (MAGEA6) affects the response to substance of Methotrexate. [5]
Etoposide DMNH3PG Approved Melanoma-associated antigen 6 (MAGEA6) affects the response to substance of Etoposide. [5]
Mitomycin DMH0ZJE Approved Melanoma-associated antigen 6 (MAGEA6) affects the response to substance of Mitomycin. [5]
Mitoxantrone DMM39BF Approved Melanoma-associated antigen 6 (MAGEA6) affects the response to substance of Mitoxantrone. [5]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Melanoma-associated antigen 6 (MAGEA6). [1]
------------------------------------------------------------------------------------
3 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Decitabine DMQL8XJ Approved Decitabine affects the expression of Melanoma-associated antigen 6 (MAGEA6). [2]
Fluorouracil DMUM7HZ Approved Fluorouracil decreases the expression of Melanoma-associated antigen 6 (MAGEA6). [3]
GALLICACID DM6Y3A0 Investigative GALLICACID increases the expression of Melanoma-associated antigen 6 (MAGEA6). [4]
------------------------------------------------------------------------------------

References

1 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
2 The DNA demethylating agent 5-aza-2'-deoxycytidine activates NY-ESO-1 antigenicity in orthotopic human glioma. Int J Cancer. 2008 Jun 1;122(11):2542-53. doi: 10.1002/ijc.23407.
3 Dissecting progressive stages of 5-fluorouracil resistance in vitro using RNA expression profiling. Int J Cancer. 2004 Nov 1;112(2):200-12. doi: 10.1002/ijc.20401.
4 Gene expression profile analysis of gallic acid-induced cell death process. Sci Rep. 2021 Aug 18;11(1):16743. doi: 10.1038/s41598-021-96174-1.
5 Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.