Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTIN1T0L)

DOT Name	Small integral membrane protein 5 (SMIM5)
Gene Name	SMIM5
Related Disease	Clear cell renal carcinoma ( )
UniProt ID	SMIM5_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF15831
Sequence	MAATDFVQEMRAVGERLLLKLQRLPQAEPVEIVAFSVIILFTATVLLLLLIACSCCCTHC CCPERRGRKVQVQPTPP

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance		REF
Clear cell renal carcinoma	DISBXRFJ	Strong	Biomarker	[1]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Small integral membrane protein 5 (SMIM5).	[2]
------------------------------------------------------------------------------------

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Small integral membrane protein 5 (SMIM5).	[3]
Hydroquinone	DM6AVR4	Approved	Hydroquinone increases the expression of Small integral membrane protein 5 (SMIM5).	[4]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Small integral membrane protein 5 (SMIM5).	[5]
------------------------------------------------------------------------------------

References

1	FUT11 as a potential biomarker of clear cell renal cell carcinoma progression based on meta-analysis of gene expression data.Tumour Biol. 2014 Mar;35(3):2607-17. doi: 10.1007/s13277-013-1344-4. Epub 2013 Dec 8.
2	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
3	Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
4	Keratinocyte-derived IL-36gama plays a role in hydroquinone-induced chemical leukoderma through inhibition of melanogenesis in human epidermal melanocytes. Arch Toxicol. 2019 Aug;93(8):2307-2320.
5	CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.