General Information of Drug Off-Target (DOT) (ID: OTITCGHB)

DOT Name Baculoviral IAP repeat-containing protein 7 (BIRC7)
Synonyms EC 2.3.2.27; Kidney inhibitor of apoptosis protein; KIAP; Livin; Melanoma inhibitor of apoptosis protein; ML-IAP; RING finger protein 50; RING-type E3 ubiquitin transferase BIRC7
Gene Name BIRC7
UniProt ID
BIRC7_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1OXN; 1OXQ; 1OY7; 1TW6; 2I3H; 2I3I; 3F7G; 3F7H; 3F7I; 3GT9; 3GTA; 3UW5; 4AUQ
EC Number
2.3.2.27
Pfam ID
PF00653 ; PF13920
Sequence
MGPKDSAKCLHRGPQPSHWAAGDGPTQERCGPRSLGSPVLGLDTCRAWDHVDGQILGQLR
PLTEEEEEEGAGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQD
KVRCFFCYGGLQSWKRGDDPWTEHAKWFPSCQFLLRSKGRDFVHSVQETHSQLLGSWDPW
EEPEDAAPVAPSVPASGYPELPTPRREVQSESAQEPGGVSPAEAQRAWWVLEPPGARDVE
AQLRRLQEERTCKVCLDRAVSIVFVPCGHLVCAECAPGLQLCPICRAPVRSRVRTFLS
Function
Apoptotic regulator capable of exerting proapoptotic and anti-apoptotic activities and plays crucial roles in apoptosis, cell proliferation, and cell cycle control. Its anti-apoptotic activity is mediated through the inhibition of CASP3, CASP7 and CASP9, as well as by its E3 ubiquitin-protein ligase activity. As it is a weak caspase inhibitor, its anti-apoptotic activity is thought to be due to its ability to ubiquitinate DIABLO/SMAC targeting it for degradation thereby promoting cell survival. May contribute to caspase inhibition, by blocking the ability of DIABLO/SMAC to disrupt XIAP/BIRC4-caspase interactions. Protects against apoptosis induced by TNF or by chemical agents such as adriamycin, etoposide or staurosporine. Suppression of apoptosis is mediated by activation of MAPK8/JNK1, and possibly also of MAPK9/JNK2. This activation depends on TAB1 and MAP3K7/TAK1. In vitro, inhibits CASP3 and proteolytic activation of pro-CASP9 ; [Isoform 1]: Blocks staurosporine-induced apoptosis. Promotes natural killer (NK) cell-mediated killing ; [Isoform 2]: Blocks etoposide-induced apoptosis. Protects against natural killer (NK) cell-mediated killing.
Tissue Specificity
Isoform 1 and isoform 2 are expressed at very low levels or not detectable in most adult tissues. Detected in adult heart, placenta, lung, lymph node, spleen and ovary, and in several carcinoma cell lines. Isoform 2 is detected in fetal kidney, heart and spleen, and at lower levels in adult brain, skeletal muscle and peripheral blood leukocytes.
KEGG Pathway
Ubiquitin mediated proteolysis (hsa04120 )
Apoptosis - multiple species (hsa04215 )
Toxoplasmosis (hsa05145 )
Pathways in cancer (hsa05200 )
Small cell lung cancer (hsa05222 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 3 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Fluorouracil DMUM7HZ Approved Baculoviral IAP repeat-containing protein 7 (BIRC7) decreases the response to substance of Fluorouracil. [12]
Etoposide DMNH3PG Approved Baculoviral IAP repeat-containing protein 7 (BIRC7) decreases the response to substance of Etoposide. [12]
Vinblastine DM5TVS3 Approved Baculoviral IAP repeat-containing protein 7 (BIRC7) decreases the response to substance of Vinblastine. [12]
------------------------------------------------------------------------------------
3 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Baculoviral IAP repeat-containing protein 7 (BIRC7). [1]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene affects the methylation of Baculoviral IAP repeat-containing protein 7 (BIRC7). [10]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the methylation of Baculoviral IAP repeat-containing protein 7 (BIRC7). [11]
------------------------------------------------------------------------------------
8 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of Baculoviral IAP repeat-containing protein 7 (BIRC7). [2]
Doxorubicin DMVP5YE Approved Doxorubicin increases the expression of Baculoviral IAP repeat-containing protein 7 (BIRC7). [3]
Estradiol DMUNTE3 Approved Estradiol increases the expression of Baculoviral IAP repeat-containing protein 7 (BIRC7). [4]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide increases the expression of Baculoviral IAP repeat-containing protein 7 (BIRC7). [5]
Testosterone DM7HUNW Approved Testosterone decreases the expression of Baculoviral IAP repeat-containing protein 7 (BIRC7). [6]
Bortezomib DMNO38U Approved Bortezomib decreases the expression of Baculoviral IAP repeat-containing protein 7 (BIRC7). [7]
Resveratrol DM3RWXL Phase 3 Resveratrol decreases the expression of Baculoviral IAP repeat-containing protein 7 (BIRC7). [8]
Curcumin DMQPH29 Phase 3 Curcumin increases the expression of Baculoviral IAP repeat-containing protein 7 (BIRC7). [9]
------------------------------------------------------------------------------------
⏷ Show the Full List of 8 Drug(s)

References

1 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
2 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
3 Rapid induction of IAP family proteins and Smac/DIABLO expression after proapoptotic stimulation with doxorubicin in RPMI 8226 multiple myeloma cells. Exp Mol Pathol. 2007 Dec;83(3):405-12. doi: 10.1016/j.yexmp.2007.04.001. Epub 2007 Apr 18.
4 Molecular mechanism of action of bisphenol and bisphenol A mediated by oestrogen receptor alpha in growth and apoptosis of breast cancer cells. Br J Pharmacol. 2013 May;169(1):167-78.
5 Curcumin reduces the expression of survivin, leading to enhancement of arsenic trioxide-induced apoptosis in myelodysplastic syndrome and leukemia stem-like cells. Oncol Rep. 2016 Sep;36(3):1233-42. doi: 10.3892/or.2016.4944. Epub 2016 Jul 15.
6 The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
7 [Effects of bortezomib alone or combined with arsenic trioxide on the apoptosis of Jurkat cells and expression of livin mRNA]. Zhongguo Shi Yan Xue Ye Xue Za Zhi. 2011 Aug;19(4):898-901.
8 Resveratrol at anti-angiogenesis/anticancer concentrations suppresses protein kinase G signaling and decreases IAPs expression in HUVECs. Anticancer Res. 2015 Jan;35(1):273-81.
9 Antitumor effects of curcumin, alone or in combination with cisplatin or doxorubicin, on human hepatic cancer cells. Analysis of their possible relationship to changes in NF-kB activation levels and in IAP gene expression. Cancer Lett. 2005 Jun 16;224(1):53-65. doi: 10.1016/j.canlet.2004.10.051.
10 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
11 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
12 Targeted inhibition of Livin resensitizes renal cancer cells towards apoptosis. Cell Mol Life Sci. 2007 May;64(9):1137-44. doi: 10.1007/s00018-007-6510-7.