Details of Drug Off-Target (DOT)
General Information of Drug Off-Target (DOT) (ID: OTIUY7E6)
| DOT Name | Cytochrome P450 4F12 (CYP4F12) | ||||
|---|---|---|---|---|---|
| Synonyms | EC 1.14.14.1; CYPIVF12 | ||||
| Gene Name | CYP4F12 | ||||
| UniProt ID | |||||
| 3D Structure | |||||
| EC Number | |||||
| Pfam ID | |||||
| Sequence |
MSLLSLPWLGLRPVATSPWLLLLLVVGSWLLARILAWTYAFYNNCRRLQCFPQPPKRNWF
WGHLGLITPTEEGLKNSTQMSATYSQGFTVWLGPIIPFIVLCHPDTIRSITNASAAIAPK DNLFIRFLKPWLGEGILLSGGDKWSRHRRMLTPAFHFNILKSYITIFNKSANIMLDKWQH LASEGSSRLDMFEHISLMTLDSLQKCIFSFDSHCQERPSEYIATILELSALVEKRSQHIL QHMDFLYYLSHDGRRFHRACRLVHDFTDAVIRERRRTLPTQGIDDFFKDKAKSKTLDFID VLLLSKDEDGKALSDEDIRAEADTFMFGGHDTTASGLSWVLYNLARHPEYQERCRQEVQE LLKDRDPKEIEWDDLAQLPFLTMCVKESLRLHPPAPFISRCCTQDIVLPDGRVIPKGITC LIDIIGVHHNPTVWPDPEVYDPFRFDPENSKGRSPLAFIPFSAGPRNCIGQAFAMAEMKV VLALMLLHFRFLPDHTEPRRKLELIMRAEGGLWLRVEPLNVSLQ |
||||
| Function |
A cytochrome P450 monooxygenase involved in the metabolism of endogenous polyunsaturated fatty acids (PUFAs). Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the second into a water molecule, with two electrons provided by NADPH via cytochrome P450 reductase (CPR; NADPH-ferrihemoprotein reductase). Catalyzes the hydroxylation of carbon hydrogen bonds, with preference for omega-2 position. Metabolizes (5Z,8Z,11Z,14Z)-eicosatetraenoic acid (arachidonate) toward 18-hydroxy arachidonate. Catalyzes the epoxidation of double bonds of PUFAs such as docosapentaenoic and docosahexaenoic acids. Has low omega-hydroxylase activity toward leukotriene B4 and arachidonate. Involved in the metabolism of xenobiotics. Catalyzes the hydroxylation of the antihistamine drug ebastine.
|
||||
| Tissue Specificity | Expressed in small intestine, liver, colon and heart. | ||||
| Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DOT
| Molecular Interaction Atlas (MIA) | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
10 Drug(s) Affected the Gene/Protein Processing of This DOT
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
