Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTIX9POY)

DOT Name Amphoterin-induced protein 3 (AMIGO3)
Synonyms AMIGO-3; Alivin-3
Gene Name AMIGO3
Related Disease
Cone-rod dystrophy 2 ( )
Sciatic neuropathy ( )
UniProt ID
AMGO3_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00560 ; PF13855
Sequence
MTWLVLLGTLLCMLRVGLGTPDSEGFPPRALHNCPYKCICAADLLSCTGLGLQDVPAELP
AATADLDLSHNALQRLRPGWLAPLFQLRALHLDHNELDALGRGVFVNASGLRLLDLSSNT
LRALGRHDLDGLGALEKLLLFNNRLVHLDEHAFHGLRALSHLYLGCNELASFSFDHLHGL
SATHLLTLDLSSNRLGHISVPELAALPAFLKNGLYLHNNPLPCDCRLYHLLQRWHQRGLS
AVRDFAREYVCLAFKVPASRVRFFQHSRVFENCSSAPALGLERPEEHLYALVGRSLRLYC
NTSVPAMRIAWVSPQQELLRAPGSRDGSIAVLADGSLAIGNVQEQHAGLFVCLATGPRLH
HNQTHEYNVSVHFPRPEPEAFNTGFTTLLGCAVGLVLVLLYLFAPPCRCCRRACRCRRWP
QTPSPLQELSAQSSVLSTTPPDAPSRKASVHKHVVFLEPGRRGLNGRVQLAVAEEFDLYN
PGGLQLKAGSESASSIGSEGPMTT
Function May mediate heterophilic cell-cell interaction. May contribute to signal transduction through its intracellular domain.

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Cone-rod dystrophy 2 DISX2RWY Definitive Altered Expression [1]
Sciatic neuropathy DISMGDKX Strong Biomarker [2]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Amphoterin-induced protein 3 (AMIGO3). [3]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Amphoterin-induced protein 3 (AMIGO3). [7]
------------------------------------------------------------------------------------
4 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of Amphoterin-induced protein 3 (AMIGO3). [4]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of Amphoterin-induced protein 3 (AMIGO3). [5]
Urethane DM7NSI0 Phase 4 Urethane increases the expression of Amphoterin-induced protein 3 (AMIGO3). [6]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 increases the expression of Amphoterin-induced protein 3 (AMIGO3). [8]
------------------------------------------------------------------------------------

References

1 LINGO-1 and AMIGO3, potential therapeutic targets for neurological and dysmyelinating disorders?.Neural Regen Res. 2017 Aug;12(8):1247-1251. doi: 10.4103/1673-5374.213538.
2 AMIGO3 is an NgR1/p75 co-receptor signalling axon growth inhibition in the acute phase of adult central nervous system injury.PLoS One. 2013 Apr 16;8(4):e61878. doi: 10.1371/journal.pone.0061878. Print 2013.
3 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
4 Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
5 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
6 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
7 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
8 Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.