Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTJ9XP1Z)

• DOT Name: F-box only protein 50 (NCCRP1)
• Synonyms: NCC receptor protein 1 homolog; NCCRP-1; Non-specific cytotoxic cell receptor protein 1 homolog
• Gene Name: NCCRP1
• Related Disease:
  Gastric cancer
  Stomach cancer
• UniProt ID: FBX50_HUMAN
• Pfam ID: PF04300
• Sequence:
  MEEVREGHALGGGMEADGPASLQELPPSPRSPSPPPSPPPLPSPPSLPSPAAPEAPELPE
  PAQPSEAHARQLLLEEWGPLSGGLELPQRLTWKLLLLRRPLYRNLLRSPNPEGINIYEPA
  PPTGPTQRPLETLGNFRGWYIRTEKLQQNQSWTVKQQCVDLLAEGLWEELLDDEQPAITV
  MDWFEDSRLDACVYELHVWLLAADRRTVIAQHHVAPRTSGRGPPGRWVQVSHVFRHYGPG
  VRFIHFLHKAKNRMEPGGLRRTRVTDSSVSVQLRE
• Function: Promotes cell proliferation.
• Tissue Specificity: Expressed in the esophagus, oral cavity, skin, tongue and reproductive organs.

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Gastric cancer	DISXGOUK	Strong	Altered Expression	[1]
Stomach cancer	DISKIJSX	Strong	Altered Expression	[1]

6 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of F-box only protein 50 (NCCRP1).	[2]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of F-box only protein 50 (NCCRP1).	[3]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of F-box only protein 50 (NCCRP1).	[4]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of F-box only protein 50 (NCCRP1).	[6]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of F-box only protein 50 (NCCRP1).	[7]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of F-box only protein 50 (NCCRP1).	[8]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of F-box only protein 50 (NCCRP1).	[5]

References

• [1] FBXO50 Enhances the Malignant Behavior of Gastric Cancer Cells.Ann Surg Oncol. 2017 Nov;24(12):3771-3779. doi: 10.1245/s10434-017-5882-7. Epub 2017 May 30.
• [2] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [3] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [4] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [5] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [6] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [7] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [8] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.