Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTJA37NU)

DOT Name	Retrotransposon Gag-like protein 8C (RTL8C)
Synonyms	Mammalian retrotransposon derived protein 8C
Gene Name	RTL8C
Related Disease	Colorectal carcinoma ( ) Wilms tumor ( )
UniProt ID	RTL8C_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF16297
Sequence	MDGRVQLIKALLALPIRPATRRWRNPIPFPETFDGDTDRLPEFIVQTGSYMFVDENTFSS DALKVTFLITRLTGPALQWVIPYIKKESPLLNDYRGFLAEMKRVFGWEEDEDF

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Colorectal carcinoma	DIS5PYL0	Limited	Genetic Variation	[1]
Wilms tumor	DISB6T16	Limited	Biomarker	[1]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Fluorouracil	DMUM7HZ	Approved	Retrotransposon Gag-like protein 8C (RTL8C) affects the response to substance of Fluorouracil.	[8]
------------------------------------------------------------------------------------

6 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Retrotransposon Gag-like protein 8C (RTL8C).	[2]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Retrotransposon Gag-like protein 8C (RTL8C).	[3]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Retrotransposon Gag-like protein 8C (RTL8C).	[4]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Retrotransposon Gag-like protein 8C (RTL8C).	[5]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol increases the expression of Retrotransposon Gag-like protein 8C (RTL8C).	[6]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Retrotransposon Gag-like protein 8C (RTL8C).	[7]
------------------------------------------------------------------------------------


⏷ Show the Full List of 6 Drug(s)

References

1	Methylation profile of the promoter CpG islands of 31 genes that may contribute to colorectal carcinogenesis.World J Gastroenterol. 2004 Dec 1;10(23):3441-54. doi: 10.3748/wjg.v10.i23.3441.
2	Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
3	Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
4	Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
5	Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
6	Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
7	Benzo[a]pyrene-induced changes in microRNA-mRNA networks. Chem Res Toxicol. 2012 Apr 16;25(4):838-49.
8	Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.