Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTJBGMQU)

• DOT Name: RWD domain-containing protein 2B (RWDD2B)
• Gene Name: RWDD2B
• UniProt ID: RWD2B_HUMAN
• PDB ID: 2DAX
• Pfam ID: PF06544 ; PF05773
• Sequence:
  MKIELSMQPWNPGYSSEGATAQETYTCPKMIEMEQAEAQLAELDLLASMFPGENELIVND
  QLAVAELKDCIEKKTMEGRSSKVYFTINMNLDVSDEKMAMFSLACILPFKYPAVLPEITV
  RSVLLSRSQQTQLNTDLTAFLQKHCHGDVCILNATEWVREHASGYVSRDTSSSPTTGSTV
  QSVDLIFTRLWIYSHHIYNKCKRKNILEWAKELSLSGFSMPGKPGVVCVEGPQSACEEFW
  SRLRKLNWKRILIRHREDIPFDGTNDETERQRKFSIFEEKVFSVNGARGNHMDFGQLYQF
  LNTKGCGDVFQMFFGVEGQ
• Tissue Specificity: Ubiquitous.

Molecular Interaction Atlas (MIA) of This DOT

11 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of RWD domain-containing protein 2B (RWDD2B).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of RWD domain-containing protein 2B (RWDD2B).	[2]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of RWD domain-containing protein 2B (RWDD2B).	[3]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of RWD domain-containing protein 2B (RWDD2B).	[4]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of RWD domain-containing protein 2B (RWDD2B).	[5]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of RWD domain-containing protein 2B (RWDD2B).	[6]
Testosterone	DM7HUNW	Approved	Testosterone increases the expression of RWD domain-containing protein 2B (RWDD2B).	[7]
Sodium lauryl sulfate	DMLJ634	Approved	Sodium lauryl sulfate decreases the expression of RWD domain-containing protein 2B (RWDD2B).	[8]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of RWD domain-containing protein 2B (RWDD2B).	[9]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of RWD domain-containing protein 2B (RWDD2B).	[6]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of RWD domain-containing protein 2B (RWDD2B).	[10]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [3] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [4] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [5] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [6] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [7] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [8] CXCL14 downregulation in human keratinocytes is a potential biomarker for a novel in vitro skin sensitization test. Toxicol Appl Pharmacol. 2020 Jan 1;386:114828. doi: 10.1016/j.taap.2019.114828. Epub 2019 Nov 14.
• [9] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [10] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.