Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTK7M4BZ)

• DOT Name: Ribosomal biogenesis factor (RBIS)
• Gene Name: RBIS
• UniProt ID: RBIS_HUMAN
• Pfam ID: PF15679
• Sequence:
  MAKNKLRGPKSRNVFHIASQKNFKAKNKAKPVTTNLKKINIMNEEKVNRVNKAFVNVQKE
  LAHFAKSISLEPLQKELIPQQRHESKPVNVDEATRLMALL
• Function: Trans-acting factor in ribosome biogenesis required for efficient 40S and 60S subunit production.

Molecular Interaction Atlas (MIA) of This DOT

7 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Ribosomal biogenesis factor (RBIS).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Ribosomal biogenesis factor (RBIS).	[2]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Ribosomal biogenesis factor (RBIS).	[3]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Ribosomal biogenesis factor (RBIS).	[4]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide decreases the expression of Ribosomal biogenesis factor (RBIS).	[5]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Ribosomal biogenesis factor (RBIS).	[6]
chloropicrin	DMSGBQA	Investigative	chloropicrin increases the expression of Ribosomal biogenesis factor (RBIS).	[7]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [3] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [4] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [5] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [6] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [7] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.