Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTKC7SG5)

• DOT Name: Ribonuclease P protein subunit p20 (POP7)
• Synonyms: RNaseP protein p20; Ribonucleases P/MRP protein subunit POP7 homolog; hPOP7
• Gene Name: POP7
• Related Disease:
  Inflammatory bowel disease
  Prostate cancer
  Prostate carcinoma
  Spinal muscular atrophy
  Ulcerative colitis
• UniProt ID: POP7_HUMAN
• PDB ID: 6AHR; 6AHU; 6CWX; 6LT7
• Pfam ID: PF12328
• Sequence:
  MAENREPRGAVEAELDPVEYTLRKRLPSRLPRRPNDIYVNMKTDFKAQLARCQKLLDGGA
  RGQNACSEIYIHGLGLAINRAINIALQLQAGSFGSLQVAANTSTVELVDELEPETDTREP
  LTRIRNNSAIHIRVFRVTPK
• Function: Component of ribonuclease P, a ribonucleoprotein complex that generates mature tRNA molecules by cleaving their 5'-ends. Also a component of the MRP ribonuclease complex, which cleaves pre-rRNA sequences.
• KEGG Pathway: Ribosome biogenesis in eukaryotes (hsa03008)
• Reactome Pathway: tRNA processing in the nucleus (R-HSA-6784531)

Molecular Interaction Atlas (MIA) of This DOT

5 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Inflammatory bowel disease	DISGN23E	Strong	Genetic Variation	[1]
Prostate cancer	DISF190Y	Strong	Genetic Variation	[2]
Prostate carcinoma	DISMJPLE	Strong	Genetic Variation	[2]
Spinal muscular atrophy	DISTLKOB	Strong	Genetic Variation	[3]
Ulcerative colitis	DIS8K27O	Strong	Biomarker	[1]

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Ribonuclease P protein subunit p20 (POP7).	[4]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Ribonuclease P protein subunit p20 (POP7).	[5]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Ribonuclease P protein subunit p20 (POP7).	[6]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Ribonuclease P protein subunit p20 (POP7).	[7]
Piroxicam	DMTK234	Approved	Piroxicam decreases the expression of Ribonuclease P protein subunit p20 (POP7).	[8]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide decreases the expression of Ribonuclease P protein subunit p20 (POP7).	[10]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN decreases the expression of Ribonuclease P protein subunit p20 (POP7).	[11]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Ribonuclease P protein subunit p20 (POP7).	[12]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Ribonuclease P protein subunit p20 (POP7).	[9]

References

• [1] DNA Methylation Profiling in Inflammatory Bowel Disease Provides New Insights into Disease Pathogenesis.J Crohns Colitis. 2016 Jan;10(1):77-86. doi: 10.1093/ecco-jcc/jjv176. Epub 2015 Sep 28.
• [2] Novel biomarkers for prostate cancer including noncoding transcripts.Am J Pathol. 2009 Dec;175(6):2264-76. doi: 10.2353/ajpath.2009.080868. Epub 2009 Nov 5.
• [3] Rpp20 interacts with SMN and is re-distributed into SMN granules in response to stress.Biochem Biophys Res Commun. 2004 Jan 30;314(1):268-76. doi: 10.1016/j.bbrc.2003.12.084.
• [4] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [5] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [6] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [7] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [8] Apoptosis induced by piroxicam plus cisplatin combined treatment is triggered by p21 in mesothelioma. PLoS One. 2011;6(8):e23569.
• [9] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [10] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [11] Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
• [12] Isobaric tags for relative and absolute quantitation-based proteomics analysis of the effect of ginger oil on bisphenol A-induced breast cancer cell proliferation. Oncol Lett. 2021 Feb;21(2):101. doi: 10.3892/ol.2020.12362. Epub 2020 Dec 8.