Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTKG8IUG)

• DOT Name: Tetratricopeptide repeat protein 31 (TTC31)
• Synonyms: TPR repeat protein 31
• Gene Name: TTC31
• UniProt ID: TTC31_HUMAN
• Pfam ID: PF13432
• Sequence:
  MAPIPKTVGRIKLDCSLRPSCPLEVAAAPKLCKEFGPEDYGEEDIVDFLRRLVESDPQGL
  HRIHVDGSSGRLQLWHHDYLLGHLDDEGKSTGQSDRGKGAEGLGTYCGLRKSFLYPPQES
  EPCPQSPSASATFPSVSDSLLQVAMPQKLLVTEEEANRLAEELVAEEERMKQKAEKKRLK
  KKRQKERKRQERLEQYCGEPKASTTSDGDESPPSSPGNPVQGQCGEEEDSLDLSSTFVSL
  ALRKVGDWPLSARREKGLNQEPQGRGLALQKMGQEEESPPREERPQQSPKVQASPGLLAA
  ALQQSQELAKLGTSFAQNGFYHEAVVLFTQALKLNPQDHRLFGNRSFCHERLGQPAWALA
  DAQVALTLRPGWPRGLFRLGKALMGLQRFREAAAVFQETLRGGSQPDAARELRSCLLHLT
  LQGQRGGICAPPLSPGALQPLPHAELAPSGLPSLRCPRSTALRSPGLSPLLHYPSCHRSH
  PNQPLSQTQSRRPHPLKPQDPSKGWDILGLGLQHLSQAR

Molecular Interaction Atlas (MIA) of This DOT

7 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Tetratricopeptide repeat protein 31 (TTC31).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Tetratricopeptide repeat protein 31 (TTC31).	[2]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Tetratricopeptide repeat protein 31 (TTC31).	[3]
Selenium	DM25CGV	Approved	Selenium decreases the expression of Tetratricopeptide repeat protein 31 (TTC31).	[4]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Tetratricopeptide repeat protein 31 (TTC31).	[5]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol decreases the expression of Tetratricopeptide repeat protein 31 (TTC31).	[4]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide decreases the expression of Tetratricopeptide repeat protein 31 (TTC31).	[6]

References

• [1] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [2] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [3] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [4] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [5] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [6] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.