Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTKN7E89)

• DOT Name: CKLF-like MARVEL transmembrane domain-containing protein 1 (CMTM1)
• Synonyms: Chemokine-like factor superfamily member 1
• Gene Name: CMTM1
• Related Disease:
  Adult glioblastoma
  Adult lymphoma
  Glioblastoma multiforme
  Lymphoma
  Non-small-cell lung cancer
  Pediatric lymphoma
  Advanced cancer
  Breast cancer
  Breast carcinoma
  Breast neoplasm
  Neoplasm
  X-linked myotubular myopathy
• UniProt ID: CKLF1_HUMAN
• Sequence:
  MDPEHAKPESSEAPSGNLKQPETAAALSLILGALACFIITQANESFITITSLEICIVVFF
  ILIYVLTLHHLLTYLHWPLLDLTNSIITAVFLSVVAILAMQEKKRRHLLYVGGSLCLTAV
  IVCCIDAFVVTTKMRTNLKRFLGVEVERKLSPAKDAYPETGPDAPQRPA
• Tissue Specificity: Highly expressed in testis.

Molecular Interaction Atlas (MIA) of This DOT

12 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Adult glioblastoma	DISVP4LU	Strong	Biomarker	[1]
Adult lymphoma	DISK8IZR	Strong	Biomarker	[2]
Glioblastoma multiforme	DISK8246	Strong	Biomarker	[1]
Lymphoma	DISN6V4S	Strong	Biomarker	[2]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Altered Expression	[3]
Pediatric lymphoma	DIS51BK2	Strong	Biomarker	[2]
Advanced cancer	DISAT1Z9	Limited	Biomarker	[4]
Breast cancer	DIS7DPX1	Limited	Biomarker	[4]
Breast carcinoma	DIS2UE88	Limited	Biomarker	[4]
Breast neoplasm	DISNGJLM	Limited	Biomarker	[4]
Neoplasm	DISZKGEW	Limited	Biomarker	[2]
X-linked myotubular myopathy	DISJ95GS	Limited	Biomarker	[5]

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of CKLF-like MARVEL transmembrane domain-containing protein 1 (CMTM1).	[6]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of CKLF-like MARVEL transmembrane domain-containing protein 1 (CMTM1).	[7]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of CKLF-like MARVEL transmembrane domain-containing protein 1 (CMTM1).	[8]

References

• [1] Systematic investigation of CMTM family genes suggests relevance to glioblastoma pathogenesis and CMTM1 and CMTM3 as priority targets.Genes Chromosomes Cancer. 2015 Jul;54(7):433-43. doi: 10.1002/gcc.22255. Epub 2015 Apr 30.
• [2] A novel protein CMTM1-v5 specifically induced human lymphoma cells apoptosis in vitro and in vivo.Exp Cell Res. 2019 Dec 1;385(1):111623. doi: 10.1016/j.yexcr.2019.111623. Epub 2019 Sep 19.
• [3] CMTM1_v17 is associated with chemotherapy resistance and poor prognosis in non-small cell lung cancer.World J Surg Oncol. 2017 Jan 28;15(1):34. doi: 10.1186/s12957-016-1094-z.
• [4] CMTM1_v17 is a novel potential therapeutic target in breast cancer.Oncol Rep. 2014 Nov;32(5):1829-36. doi: 10.3892/or.2014.3429. Epub 2014 Aug 20.
• [5] AAV-Mediated Gene Transfer Restores a Normal Muscle Transcriptome in a Canine Model of X-Linked Myotubular Myopathy.Mol Ther. 2020 Feb 5;28(2):382-393. doi: 10.1016/j.ymthe.2019.10.018. Epub 2019 Nov 11.
• [6] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [7] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [8] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.