Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTKOF54H)

DOT Name Synaptonemal complex protein 3 (SYCP3)
Synonyms SCP-3
Gene Name SYCP3
Related Disease
Acute monocytic leukemia ( )
Acute myelogenous leukaemia ( )
Advanced cancer ( )
Azoospermia ( )
Cardiac failure ( )
Cervical cancer ( )
Cervical carcinoma ( )
Cervical Intraepithelial neoplasia ( )
Clear cell renal carcinoma ( )
Congestive heart failure ( )
Lung cancer ( )
Lung carcinoma ( )
Male infertility ( )
Myeloid leukaemia ( )
Neoplasm ( )
Non-small-cell lung cancer ( )
Progressive multifocal leukoencephalopathy ( )
Spontaneous abortion ( )
Childhood kidney Wilms tumor ( )
Wilms tumor ( )
Cryptorchidism ( )
UniProt ID
SYCP3_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
4CPC
Pfam ID
PF04803
Sequence
MVSSGKKYSRKSGKPSVEDQFTRAYDFETEDKKDLSGSEEDVIEGKTAVIEKRRKKRSSA
GVVEDMGGEVQNMLEGVGVDINKALLAKRKRLEMYTKASLKTSNQKIEHVWKTQQDQRQK
LNQEYSQQFLTLFQQWDLDMQKAEEQEEKILNMFRQQQKILQQSRIVQSQRLKTIKQLYE
QFIKSMEELEKNHDNLLTGAQNEFKKEMAMLQKKIMMETQQQEIASVRKSLQSMLF
Function
Component of the synaptonemal complexes (SCS), formed between homologous chromosomes during meiotic prophase. Required for centromere pairing during meiosis in male germ cells. Required for normal meiosis during spermatogenesis and male fertility. Plays a lesser role in female fertility. Required for efficient phosphorylation of HORMAD1 and HORMAD2.
Tissue Specificity Testis-specific.
KEGG Pathway
Homologous recombi.tion (hsa03440 )
Reactome Pathway
Meiotic synapsis (R-HSA-1221632 )

Molecular Interaction Atlas (MIA) of This DOT

21 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Acute monocytic leukemia DIS28NEL Strong Altered Expression [1]
Acute myelogenous leukaemia DISCSPTN Strong Altered Expression [1]
Advanced cancer DISAT1Z9 Strong Biomarker [2]
Azoospermia DIS94181 Strong Genetic Variation [3]
Cardiac failure DISDC067 Strong Biomarker [4]
Cervical cancer DISFSHPF Strong Biomarker [5]
Cervical carcinoma DIST4S00 Strong Biomarker [5]
Cervical Intraepithelial neoplasia DISXP757 Strong Altered Expression [5]
Clear cell renal carcinoma DISBXRFJ Strong Altered Expression [6]
Congestive heart failure DIS32MEA Strong Biomarker [4]
Lung cancer DISCM4YA Strong Altered Expression [7]
Lung carcinoma DISTR26C Strong Altered Expression [7]
Male infertility DISY3YZZ Strong Biomarker [8]
Myeloid leukaemia DISMN944 Strong Altered Expression [1]
Neoplasm DISZKGEW Strong Altered Expression [5]
Non-small-cell lung cancer DIS5Y6R9 Strong Biomarker [7]
Progressive multifocal leukoencephalopathy DISX02WS Strong Altered Expression [6]
Spontaneous abortion DISOWLOH moderate Biomarker [9]
Childhood kidney Wilms tumor DIS0NMK3 Disputed Altered Expression [10]
Wilms tumor DISB6T16 Disputed Altered Expression [10]
Cryptorchidism DISYUD2P Limited Altered Expression [11]
------------------------------------------------------------------------------------
⏷ Show the Full List of 21 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
3 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Synaptonemal complex protein 3 (SYCP3). [12]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of Synaptonemal complex protein 3 (SYCP3). [13]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of Synaptonemal complex protein 3 (SYCP3). [15]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Arsenic DMTL2Y1 Approved Arsenic affects the methylation of Synaptonemal complex protein 3 (SYCP3). [14]
------------------------------------------------------------------------------------

References

1 Expression of serologically identified tumor antigens in acute leukemias.Leuk Res. 2003 Jul;27(7):655-60. doi: 10.1016/s0145-2126(02)00230-8.
2 Targeting Cyclin D-CDK4/6 Sensitizes Immune-Refractory Cancer by Blocking the SCP3-NANOG Axis.Cancer Res. 2018 May 15;78(10):2638-2653. doi: 10.1158/0008-5472.CAN-17-2325. Epub 2018 Feb 6.
3 Mutations in the chromosome pairing gene FKBP6 are not a common cause of non-obstructive azoospermia.Mol Hum Reprod. 2005 Sep;11(9):673-5. doi: 10.1093/molehr/gah232. Epub 2005 Oct 14.
4 Cyclopeptide COR-1 to treat beta1-adrenergic receptor antibody-induced heart failure.PLoS One. 2018 Aug 20;13(8):e0201160. doi: 10.1371/journal.pone.0201160. eCollection 2018.
5 Synaptonemal complex protein 3 is a prognostic marker in cervical cancer.PLoS One. 2014 Jun 6;9(6):e98712. doi: 10.1371/journal.pone.0098712. eCollection 2014.
6 SCP phosphatases suppress renal cell carcinoma by stabilizing PML and inhibiting mTOR/HIF signaling.Cancer Res. 2014 Dec 1;74(23):6935-46. doi: 10.1158/0008-5472.CAN-14-1330. Epub 2014 Oct 7.
7 Synaptonemal complex protein 3 is associated with lymphangiogenesis in non-small cell lung cancer patients with lymph node metastasis.J Transl Med. 2017 Jun 17;15(1):138. doi: 10.1186/s12967-017-1241-5.
8 A Neofunctionalized X-Linked Ampliconic Gene Family Is Essential for Male Fertility and Equal Sex Ratio in Mice.Curr Biol. 2019 Nov 4;29(21):3699-3706.e5. doi: 10.1016/j.cub.2019.08.057. Epub 2019 Oct 17.
9 Mutations of the SYCP3 gene in women with recurrent pregnancy loss.Am J Hum Genet. 2009 Jan;84(1):14-20. doi: 10.1016/j.ajhg.2008.12.002. Epub 2008 Dec 24.
10 Effect of antiepileptic drug (Topiramate) and cold pressed ginger oil on testicular genes expression, sexual hormones and histopathological alterations in mice.Biomed Pharmacother. 2019 Feb;110:409-419. doi: 10.1016/j.biopha.2018.11.146. Epub 2018 Dec 5.
11 Effects of body temperature on the expression and localization of meiosis-related proteins STRA8 and SCP3 in boar testes.Acta Histochem. 2019 Aug;121(6):718-723. doi: 10.1016/j.acthis.2019.06.007. Epub 2019 Jun 26.
12 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
13 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
14 Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
15 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.