General Information of Drug Off-Target (DOT) (ID: OTLABE56)

DOT Name Kelch-like protein 41 (KLHL41)
Synonyms Kel-like protein 23; Kelch repeat and BTB domain-containing protein 10; Kelch-related protein 1; Sarcosin
Gene Name KLHL41
Related Disease
Cryptococcosis ( )
Nemaline myopathy 9 ( )
Childhood-onset nemaline myopathy ( )
Intermediate nemaline myopathy ( )
Severe congenital nemaline myopathy ( )
Typical nemaline myopathy ( )
Nemaline myopathy ( )
UniProt ID
KLH41_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF07707 ; PF00651 ; PF01344
Sequence
MDSQRELAEELRLYQSTLLQDGLKDLLDEKKFIDCTLKAGDKSLPCHRLILSACSPYFRE
YFLSEIDEAKKKEVVLDNVDPAILDLIIKYLYSASIDLNDGNVQDIFALASRFQIPSVFT
VCVSYLQKRLAPGNCLAILRLGLLLDCPRLAISAREFVSDRFVQICKEEDFMQLSPQELI
SVISNDSLNVEKEEAVFEAVMKWVRTDKENRVKNLSEVFDCIRFRLMTEKYFKDHVEKDD
IIKSNPDLQKKIKVLKDAFAGKLPEPSKNAAKTGAGEVNGDVGDEDLLPGYLNDIPRHGM
FVKDLILLVNDTAAVAYDPTENECYLTALAEQIPRNHSSIVTQQNQIYVVGGLYVDEENK
DQPLQSYFFQLDSIASEWVGLPPLPSARCLFGLGEVDDKIYVVAGKDLQTEASLDSVLCY
DPVAAKWNEVKKLPIKVYGHNVISHKGMIYCLGGKTDDKKCTNRVFIFNPKKGDWKDLAP
MKIPRSMFGVAVHKGKIVIAGGVTEDGLSASVEAFDLTTNKWDVMTEFPQERSSISLVSL
AGSLYAIGGFAMIQLESKEFAPTEVNDIWKYEDDKKEWAGMLKEIRYASGASCLATRLNL
FKLSKL
Function
Involved in skeletal muscle development and differentiation. Regulates proliferation and differentiation of myoblasts and plays a role in myofibril assembly by promoting lateral fusion of adjacent thin fibrils into mature, wide myofibrils. Required for pseudopod elongation in transformed cells.
Tissue Specificity Sarcomeric muscle.
Reactome Pathway
Antigen processing (R-HSA-983168 )
Neddylation (R-HSA-8951664 )

Molecular Interaction Atlas (MIA) of This DOT

7 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Cryptococcosis DISDYDTK Strong Biomarker [1]
Nemaline myopathy 9 DIS4WFUM Strong Autosomal recessive [2]
Childhood-onset nemaline myopathy DIST7MSL Supportive Autosomal dominant [2]
Intermediate nemaline myopathy DISMJ4LI Supportive Autosomal dominant [2]
Severe congenital nemaline myopathy DISJR7WP Supportive Autosomal recessive [2]
Typical nemaline myopathy DISY1645 Supportive Autosomal dominant [2]
Nemaline myopathy DIS5IYLY Limited Biomarker [3]
------------------------------------------------------------------------------------
⏷ Show the Full List of 7 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
9 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Kelch-like protein 41 (KLHL41). [4]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Kelch-like protein 41 (KLHL41). [5]
Vorinostat DMWMPD4 Approved Vorinostat increases the expression of Kelch-like protein 41 (KLHL41). [6]
Triclosan DMZUR4N Approved Triclosan decreases the expression of Kelch-like protein 41 (KLHL41). [7]
Cytarabine DMZD5QR Approved Cytarabine decreases the expression of Kelch-like protein 41 (KLHL41). [8]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of Kelch-like protein 41 (KLHL41). [9]
Leflunomide DMR8ONJ Phase 1 Trial Leflunomide decreases the expression of Kelch-like protein 41 (KLHL41). [11]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 decreases the expression of Kelch-like protein 41 (KLHL41). [12]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of Kelch-like protein 41 (KLHL41). [13]
------------------------------------------------------------------------------------
⏷ Show the Full List of 9 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Kelch-like protein 41 (KLHL41). [10]
------------------------------------------------------------------------------------

References

1 A Predicted Mannoprotein Participates in Cryptococcus gattii Capsular Structure.mSphere. 2018 Apr 25;3(2):e00023-18. doi: 10.1128/mSphere.00023-18. Print 2018 Apr 25.
2 Identification of KLHL41 Mutations Implicates BTB-Kelch-Mediated Ubiquitination as an Alternate Pathway to Myofibrillar Disruption in Nemaline Myopathy. Am J Hum Genet. 2013 Dec 5;93(6):1108-17. doi: 10.1016/j.ajhg.2013.10.020. Epub 2013 Nov 21.
3 Dysregulation of NRAP degradation by KLHL41 contributes to pathophysiology in nemaline myopathy.Hum Mol Genet. 2019 Aug 1;28(15):2549-2560. doi: 10.1093/hmg/ddz078.
4 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
5 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
6 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
7 Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
8 Cytosine arabinoside induces ectoderm and inhibits mesoderm expression in human embryonic stem cells during multilineage differentiation. Br J Pharmacol. 2011 Apr;162(8):1743-56.
9 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
10 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
11 Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
12 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
13 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.