Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTLJ4G5G)

• DOT Name: Transmembrane protein 250 (TMEM250)
• Synonyms: Herpes virus UL25-binding protein
• Gene Name: TMEM250
• UniProt ID: TM250_HUMAN
• Pfam ID: PF17685
• Sequence:
  MPVMPIPRRVRSFHGPHTTCLHAACGPVRASHLARTKYNNFDVYIKTRWLYGFIRFLLYF
  SCSLFTAALWGALAALFCLQYLGVRVLLRFQRKLSVLLLLLGRRRVDFRLVNELLVYGIH
  VTMLLVGGLGWCFMVFVDM
• Function: May play a role in cell proliferation by promoting progression into S phase; (Microbial infection) Promotes human herpes simplex virus 1/HHV-1 proliferation.

Molecular Interaction Atlas (MIA) of This DOT

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Transmembrane protein 250 (TMEM250).	[1]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Transmembrane protein 250 (TMEM250).	[6]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Transmembrane protein 250 (TMEM250).	[7]

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Transmembrane protein 250 (TMEM250).	[2]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Transmembrane protein 250 (TMEM250).	[3]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Transmembrane protein 250 (TMEM250).	[4]
Hydroxyurea	DMOQVU9	Approved	Hydroxyurea increases the expression of Transmembrane protein 250 (TMEM250).	[5]
2-deoxyglucose	DMIAHVU	Approved	2-deoxyglucose increases the expression of Transmembrane protein 250 (TMEM250).	[5]
Bleomycin	DMNER5S	Approved	Bleomycin increases the expression of Transmembrane protein 250 (TMEM250).	[5]
Camptothecin	DM6CHNJ	Phase 3	Camptothecin increases the expression of Transmembrane protein 250 (TMEM250).	[5]
GALLICACID	DM6Y3A0	Investigative	GALLICACID decreases the expression of Transmembrane protein 250 (TMEM250).	[8]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [3] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [4] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [5] Development and validation of the TGx-HDACi transcriptomic biomarker to detect histone deacetylase inhibitors in human TK6 cells. Arch Toxicol. 2021 May;95(5):1631-1645. doi: 10.1007/s00204-021-03014-2. Epub 2021 Mar 26.
• [6] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [7] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [8] Gene expression profile analysis of gallic acid-induced cell death process. Sci Rep. 2021 Aug 18;11(1):16743. doi: 10.1038/s41598-021-96174-1.