Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTLUTQ02)

• DOT Name: Polyadenylate-binding protein 5 (PABPC5)
• Synonyms: PABP-5; Poly(A)-binding protein 5
• Gene Name: PABPC5
• Related Disease: Tourette syndrome
• UniProt ID: PABP5_HUMAN
• Pfam ID: PF00076
• Sequence:
  MGSGEPNPAGKKKKYLKAALYVGDLDPDVTEDMLYKKFRPAGPLRFTRICRDPVTRSPLG
  YGYVNFRFPADAEWALNTMNFDLINGKPFRLMWSQPDDRLRKSGVGNIFIKNLDKSIDNR
  ALFYLFSAFGNILSCKVVCDDNGSKGYAYVHFDSLAAANRAIWHMNGVRLNNRQVYVGRF
  KFPEERAAEVRTRDRATFTNVFVKNIGDDIDDEKLKELFCEYGPTESVKVIRDASGKSKG
  FGFVRYETHEAAQKAVLDLHGKSIDGKVLYVGRAQKKIERLAELRRRFERLRLKEKSRPP
  GVPIYIKNLDETINDEKLKEEFSSFGSISRAKVMMEVGQGKGFGVVCFSSFEEATKAVDE
  MNGRIVGSKPLHVTLGQARRRC
• Function: Binds the poly(A) tail of mRNA. May be involved in cytoplasmic regulatory processes of mRNA metabolism. Can probably bind to cytoplasmic RNA sequences other than poly(A) in vivo.
• Tissue Specificity: Expressed in fetal brain and in a range of adult tissues.
• KEGG Pathway:
  mR. surveillance pathway (hsa03015)
  R. degradation (hsa03018)

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Tourette syndrome	DISX9D54	Limited	Unknown	[1]

7 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Polyadenylate-binding protein 5 (PABPC5).	[2]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Polyadenylate-binding protein 5 (PABPC5).	[3]
Panobinostat	DM58WKG	Approved	Panobinostat increases the expression of Polyadenylate-binding protein 5 (PABPC5).	[4]
Permethrin	DMZ0Q1G	Approved	Permethrin increases the expression of Polyadenylate-binding protein 5 (PABPC5).	[5]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Polyadenylate-binding protein 5 (PABPC5).	[6]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Polyadenylate-binding protein 5 (PABPC5).	[7]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Polyadenylate-binding protein 5 (PABPC5).	[8]

References

• [1] Microduplication of 15q13.3 and Xq21.31 in a family with Tourette syndrome and comorbidities. Am J Med Genet B Neuropsychiatr Genet. 2013 Dec;162B(8):825-31. doi: 10.1002/ajmg.b.32186. Epub 2013 Jul 27.
• [2] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [3] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [4] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [5] Exposure to Insecticides Modifies Gene Expression and DNA Methylation in Hematopoietic Tissues In Vitro. Int J Mol Sci. 2023 Mar 26;24(7):6259. doi: 10.3390/ijms24076259.
• [6] Benzo[a]pyrene-induced changes in microRNA-mRNA networks. Chem Res Toxicol. 2012 Apr 16;25(4):838-49.
• [7] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [8] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.