General Information of Drug Off-Target (DOT) (ID: OTM0709Q)

DOT Name Alpha-N-acetylglucosaminidase (NAGLU)
Synonyms EC 3.2.1.50; N-acetyl-alpha-glucosaminidase; NAG
Gene Name NAGLU
Related Disease
Mucopolysaccharidosis type 3B ( )
Charcot-Marie-Tooth disease axonal type 2V ( )
UniProt ID
ANAG_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
4XWH
EC Number
3.2.1.50
Pfam ID
PF05089 ; PF12972 ; PF12971
Sequence
MEAVAVAAAVGVLLLAGAGGAAGDEAREAAAVRALVARLLGPGPAADFSVSVERALAAKP
GLDTYSLGGGGAARVRVRGSTGVAAAAGLHRYLRDFCGCHVAWSGSQLRLPRPLPAVPGE
LTEATPNRYRYYQNVCTQSYSFVWWDWARWEREIDWMALNGINLALAWSGQEAIWQRVYL
ALGLTQAEINEFFTGPAFLAWGRMGNLHTWDGPLPPSWHIKQLYLQHRVLDQMRSFGMTP
VLPAFAGHVPEAVTRVFPQVNVTKMGSWGHFNCSYSCSFLLAPEDPIFPIIGSLFLRELI
KEFGTDHIYGADTFNEMQPPSSEPSYLAAATTAVYEAMTAVDTEAVWLLQGWLFQHQPQF
WGPAQIRAVLGAVPRGRLLVLDLFAESQPVYTRTASFQGQPFIWCMLHNFGGNHGLFGAL
EAVNGGPEAARLFPNSTMVGTGMAPEGISQNEVVYSLMAELGWRKDPVPDLAAWVTSFAA
RRYGVSHPDAGAAWRLLLRSVYNCSGEACRGHNRSPLVRRPSLQMNTSIWYNRSDVFEAW
RLLLTSAPSLATSPAFRYDLLDLTRQAVQELVSLYYEEARSAYLSKELASLLRAGGVLAY
ELLPALDEVLASDSRFLLGSWLEQARAAAVSEAEADFYEQNSRYQLTLWGPEGNILDYAN
KQLAGLVANYYTPRWRLFLEALVDSVAQGIPFQQHQFDKNVFQLEQAFVLSKQRYPSQPR
GDTVDLAKKIFLKYYPRWVAGSW
Function Involved in the degradation of heparan sulfate.
Tissue Specificity Liver, ovary, peripheral blood leukocytes, testis, prostate, spleen, colon, lung, placenta and kidney.
KEGG Pathway
Glycosaminoglycan degradation (hsa00531 )
Metabolic pathways (hsa01100 )
Lysosome (hsa04142 )
Reactome Pathway
MPS IIIB - Sanfilippo syndrome B (R-HSA-2206282 )
HS-GAG degradation (R-HSA-2024096 )

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Mucopolysaccharidosis type 3B DIS1RN28 Definitive Autosomal recessive [1]
Charcot-Marie-Tooth disease axonal type 2V DISMD18Z Supportive Autosomal dominant [2]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Alpha-N-acetylglucosaminidase (NAGLU). [3]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene affects the methylation of Alpha-N-acetylglucosaminidase (NAGLU). [14]
------------------------------------------------------------------------------------
13 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Alpha-N-acetylglucosaminidase (NAGLU). [4]
Tretinoin DM49DUI Approved Tretinoin increases the expression of Alpha-N-acetylglucosaminidase (NAGLU). [5]
Doxorubicin DMVP5YE Approved Doxorubicin increases the expression of Alpha-N-acetylglucosaminidase (NAGLU). [6]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Alpha-N-acetylglucosaminidase (NAGLU). [7]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Alpha-N-acetylglucosaminidase (NAGLU). [8]
Quercetin DM3NC4M Approved Quercetin increases the expression of Alpha-N-acetylglucosaminidase (NAGLU). [9]
Testosterone DM7HUNW Approved Testosterone decreases the expression of Alpha-N-acetylglucosaminidase (NAGLU). [10]
Selenium DM25CGV Approved Selenium increases the expression of Alpha-N-acetylglucosaminidase (NAGLU). [11]
Menadione DMSJDTY Approved Menadione affects the expression of Alpha-N-acetylglucosaminidase (NAGLU). [12]
SNDX-275 DMH7W9X Phase 3 SNDX-275 increases the expression of Alpha-N-acetylglucosaminidase (NAGLU). [13]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of Alpha-N-acetylglucosaminidase (NAGLU). [15]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Alpha-N-acetylglucosaminidase (NAGLU). [16]
PP-242 DM2348V Investigative PP-242 decreases the expression of Alpha-N-acetylglucosaminidase (NAGLU). [17]
------------------------------------------------------------------------------------
⏷ Show the Full List of 13 Drug(s)

References

1 Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
2 Adult-onset painful axonal polyneuropathy caused by a dominant NAGLU mutation. Brain. 2015 Jun;138(Pt 6):1477-83. doi: 10.1093/brain/awv074. Epub 2015 Mar 28.
3 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
4 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
5 Constitutive gene expression predisposes morphogen-mediated cell fate responses of NT2/D1 and 27X-1 human embryonal carcinoma cells. Stem Cells. 2007 Mar;25(3):771-8. doi: 10.1634/stemcells.2006-0271. Epub 2006 Nov 30.
6 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
7 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
8 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
9 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
10 The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
11 Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
12 Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
13 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
14 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
15 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
16 Bisphenol A Exposure Changes the Transcriptomic and Proteomic Dynamics of Human Retinoblastoma Y79 Cells. Genes (Basel). 2021 Feb 11;12(2):264. doi: 10.3390/genes12020264.
17 Marine biogenics in sea spray aerosols interact with the mTOR signaling pathway. Sci Rep. 2019 Jan 24;9(1):675.