Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTN38YBY)

• DOT Name: Aspartate dehydrogenase domain-containing protein (ASPDH)
• Gene Name: ASPDH
• UniProt ID: ASPDH_HUMAN
• Pfam ID: PF01958 ; PF03447
• Sequence:
  MADRGPWRVGVVGYGRLGQSLVSRLLAQGPELGLELVFVWNRDPGRMAGSVPPSLQLQNL
  AALGERRPDLVVEVAHPKIIHESGAQILRHANLLVGSPSALSDQTTERQLLEASQHWDHA
  VFVARGALWGAEDIRRLDAAGGLRSLRVTMATHPDGFRLEGPLAAAHSPGPCTVLYEGPV
  RGLCPFAPRNSNTMAAAALAAPSLGFDGVIGVLVADTSLTDMHVVDVELSGPRGPTGRSF
  AVHTRRENPAEPGAVTGSATVTAFWQSLLACCQLPSRPGIHLC
• KEGG Pathway:
  Nicoti.te and nicoti.mide metabolism (hsa00760)
  Metabolic pathways (hsa01100)
  Biosynthesis of cofactors (hsa01240)

Molecular Interaction Atlas (MIA) of This DOT

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Aspartate dehydrogenase domain-containing protein (ASPDH).	[1]
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Aspartate dehydrogenase domain-containing protein (ASPDH).	[4]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Aspartate dehydrogenase domain-containing protein (ASPDH).	[7]

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Aspartate dehydrogenase domain-containing protein (ASPDH).	[2]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Aspartate dehydrogenase domain-containing protein (ASPDH).	[3]
Rosiglitazone	DMILWZR	Approved	Rosiglitazone decreases the expression of Aspartate dehydrogenase domain-containing protein (ASPDH).	[5]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Aspartate dehydrogenase domain-containing protein (ASPDH).	[6]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [3] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [4] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [5] Transcriptomic analysis of untreated and drug-treated differentiated HepaRG cells over a 2-week period. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):27-35.
• [6] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [7] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.