Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTN8R8DQ)

• DOT Name: EEIG family member 2 (EEIG2)
• Synonyms: EEIG2
• Gene Name: EEIG2
• UniProt ID: EEIG2_HUMAN
• Pfam ID: PF10358
• Sequence:
  MMKKKKFKFKVDFELEELSSVPFVNGVLFCKMRLLDGGSFTAESSREVVQANCVRWRKKF
  SFMCKMSASAATGILDPCIYRVSVRKELKGGKAYAKLGFADLNLAEFAGSGNTTRRCLLE
  GYDTKNTRQDNSILKVLISMQLMSGDPCFKTPPSTSMSIPIAGESESLQEDRKGGETLKV
  HLGIADLSAKSASVPDELGACGHSRTSSYASQQSKVSGYSTCHSRSSSFSELCHRRNTSV
  GSTSTGVESILEPCDEIEQKIAEPNLDTADKEDTASEKLSRCPVKQDSVESQLKRVDDTR
  VDADDIVEKILQSQDFSLDSSAEEEGLRLFVGPGGSTTFGSHHLPNRVGSGAYEQVVIKR

Molecular Interaction Atlas (MIA) of This DOT

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of EEIG family member 2 (EEIG2).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of EEIG family member 2 (EEIG2).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of EEIG family member 2 (EEIG2).	[3]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of EEIG family member 2 (EEIG2).	[4]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of EEIG family member 2 (EEIG2).	[5]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of EEIG family member 2 (EEIG2).	[6]
Ethanol	DMDRQZU	Approved	Ethanol increases the expression of EEIG family member 2 (EEIG2).	[7]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of EEIG family member 2 (EEIG2).	[8]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of EEIG family member 2 (EEIG2).	[9]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of EEIG family member 2 (EEIG2).	[10]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [3] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [4] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [5] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [6] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [7] Gene expression signatures after ethanol exposure in differentiating embryoid bodies. Toxicol In Vitro. 2018 Feb;46:66-76.
• [8] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [9] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [10] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.