Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTNQOJ6S)

DOT Name Coiled-coil domain-containing protein 170 (CCDC170)
Gene Name CCDC170
Related Disease
Bipolar disorder ( )
Cardiovascular disease ( )
Estrogen-receptor positive breast cancer ( )
Major depressive disorder ( )
Neoplasm ( )
Schizophrenia ( )
Endometriosis ( )
Nasopharyngeal carcinoma ( )
Breast cancer ( )
Breast carcinoma ( )
Osteoporosis ( )
UniProt ID
CC170_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MSLDCTSHIALGAASPAPEETYDHLSEVPVTREQLNHYRNVAQNARSELAATLVKFECAQ
SELQDLRSKMLSKEVSCQELKAEMESYKENNARKSSLLTSLRDRVQELEEESAALSTSKI
RTEITAHAAIKENQELKKKVVELNEKLQKCSKENEENKKQVSKNCRKHEEFLTQLRDCLD
PDERNDKASDEDLILKLRDLRKENEFVKGQIVILEETINVHEMEAKASRETIMRLASEVN
REQKKAASCTEEKEKLNQDLLSAVEAKEALEREVKIFQERLLAGQQVWDASKQEVSLLKK
SSSELEKSLKASQDAVTTSQSQYFSFREKIAALLRGRLSMTGSTEDTILEKIREMDSREE
SRDRMVSQLEAQISELVEQLGKESGFHQKALQRAQKAENMLETLQGQLTHLEAELVSGGV
LRDNLNFEKQKYLKFLDQLSQKMKLDQMAAELGFDMRLDVVLARTEQLVRLESNAVIENK
TIAHNLQRKLKTQKERLESKELHMSLLRQKIAQLEEEKQARTALVVERDNAHLTIRNLQK
KVERLQKELNTCRDLHTELKAKLADTNELKIKTLEQTKAIEDLNKSRDQLEKMKEKAEKK
LMSVKSELDTTEHEAKENKERARNMIEVVTSEMKTLKKSLEEAEKREKQLADFREVVSQM
LGLNVTSLALPDYEIIKCLERLVHSHQHHFVTCACLKDVTTGQERHPQGHLQLLH
Function Plays a role in Golgi-associated microtubules organization and stabilization.

Molecular Interaction Atlas (MIA) of This DOT

11 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Bipolar disorder DISAM7J2 Strong Genetic Variation [1]
Cardiovascular disease DIS2IQDX Strong Genetic Variation [2]
Estrogen-receptor positive breast cancer DIS1H502 Strong Biomarker [3]
Major depressive disorder DIS4CL3X Strong Genetic Variation [1]
Neoplasm DISZKGEW Strong Biomarker [3]
Schizophrenia DISSRV2N Strong Genetic Variation [1]
Endometriosis DISX1AG8 moderate Genetic Variation [4]
Nasopharyngeal carcinoma DISAOTQ0 moderate Genetic Variation [5]
Breast cancer DIS7DPX1 Limited Biomarker [6]
Breast carcinoma DIS2UE88 Limited Genetic Variation [7]
Osteoporosis DISF2JE0 Limited Genetic Variation [8]
------------------------------------------------------------------------------------
⏷ Show the Full List of 11 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
6 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Coiled-coil domain-containing protein 170 (CCDC170). [9]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Coiled-coil domain-containing protein 170 (CCDC170). [10]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of Coiled-coil domain-containing protein 170 (CCDC170). [9]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of Coiled-coil domain-containing protein 170 (CCDC170). [11]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Coiled-coil domain-containing protein 170 (CCDC170). [9]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Coiled-coil domain-containing protein 170 (CCDC170). [12]
------------------------------------------------------------------------------------
⏷ Show the Full List of 6 Drug(s)

References

1 GWAS of Suicide Attempt in Psychiatric Disorders and Association With Major Depression Polygenic Risk Scores.Am J Psychiatry. 2019 Aug 1;176(8):651-660. doi: 10.1176/appi.ajp.2019.18080957. Epub 2019 Jun 5.
2 Leveraging Polygenic Functional Enrichment to Improve GWAS Power.Am J Hum Genet. 2019 Jan 3;104(1):65-75. doi: 10.1016/j.ajhg.2018.11.008. Epub 2018 Dec 27.
3 Recurrent ESR1-CCDC170 rearrangements in an aggressive subset of oestrogen receptor-positive breast cancers.Nat Commun. 2014 Aug 7;5:4577. doi: 10.1038/ncomms5577.
4 Meta-analysis identifies five novel loci associated with endometriosis highlighting key genes involved in hormone metabolism.Nat Commun. 2017 May 24;8:15539. doi: 10.1038/ncomms15539.
5 Multigene pathway-based analyses identify nasopharyngeal carcinoma risk associations for cumulative adverse effects of TERT-CLPTM1L and DNA double-strand breaks repair.Int J Cancer. 2014 Oct 1;135(7):1634-45. doi: 10.1002/ijc.28802. Epub 2014 Mar 4.
6 Enhanced Identification of Potential Pleiotropic Genetic Variants for Bone Mineral Density and Breast Cancer.Calcif Tissue Int. 2017 Nov;101(5):489-500. doi: 10.1007/s00223-017-0308-x. Epub 2017 Jul 31.
7 Association analysis identifies 65 new breast cancer risk loci.Nature. 2017 Nov 2;551(7678):92-94. doi: 10.1038/nature24284. Epub 2017 Oct 23.
8 Association of RMND1/CCDC170-ESR1 single nucleotide polymorphisms with hip fracture and osteoporosis in postmenopausal women.Climacteric. 2019 Feb;22(1):97-104. doi: 10.1080/13697137.2018.1538339. Epub 2019 Jan 2.
9 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
10 Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
11 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
12 CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.