Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTNS6IEC)

DOT Name	Nuclear protein 2 (NUPR2)
Synonyms	Nuclear transcriptional regulator 1-like protein; Nuclear transcriptional regulator protein 2
Gene Name	NUPR2
Related Disease	Herpes simplex infection ( ) Epstein barr virus infection ( )
UniProt ID	NUPR2_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF10195
Sequence	MEAPAERALPRLQALARPPPPISYEEELYDCLDYYYLRDFPACGAGRSKGRTRREQALRT NWPAPGGHERKVAQKLLNGQRKRRQRQLHPKMRTRLT
Function	Acts as a transcriptional repressor by inhibiting gene expression at the NUPR1 promoter in a p53/TP53-dependent manner in cancer cells. Involved in the G1 cell cycle arrest, and in a decrease in cell viability and cell proliferation. Plays a role as a negative regulator of the protumoral factor NUPR1.

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Herpes simplex infection	DISL1SAV	Strong	Biomarker	[1]
Epstein barr virus infection	DISOO0WT	moderate	Altered Expression	[2]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Nuclear protein 2 (NUPR2).	[3]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Nuclear protein 2 (NUPR2).	[6]
------------------------------------------------------------------------------------

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Nuclear protein 2 (NUPR2).	[4]
Niclosamide	DMJAGXQ	Approved	Niclosamide increases the expression of Nuclear protein 2 (NUPR2).	[5]
------------------------------------------------------------------------------------

References

1	A region of herpes simplex virus VP16 can substitute for a transforming domain of Epstein-Barr virus nuclear protein 2.Proc Natl Acad Sci U S A. 1992 Sep 1;89(17):8030-4. doi: 10.1073/pnas.89.17.8030.
2	Early events in Epstein-Barr virus infection of human B lymphocytes.Virology. 1991 Apr;181(2):595-608. doi: 10.1016/0042-6822(91)90893-g.
3	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
4	Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
5	Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
6	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.