Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTNV7F7Q)

DOT Name Doublesex- and mab-3-related transcription factor 3 (DMRT3)
Gene Name DMRT3
Related Disease
46,XY partial gonadal dysgenesis ( )
Adult germ cell tumor ( )
Cerebral palsy ( )
Germ cell tumor ( )
Germ cell tumour ( )
Hepatocellular carcinoma ( )
Spastic cerebral palsy ( )
Lung squamous cell carcinoma ( )
Nervous system disease ( )
UniProt ID
DMRT3_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00751 ; PF03474
Sequence
MNGYGSPYLYMGGPVSQPPRAPLQRTPKCARCRNHGVLSWLKGHKRYCRFKDCTCEKCIL
IIERQRVMAAQVALRRQQANESLESLIPDSLRALPGPPPPGDAVAAPQPPPASQPSQPQP
PRPAAELAAAAALRWTAEPQPGALQAQLAKPDLTEERLGDGKSADNTEVFSDKDTDQRSS
PDVAKSKGCFTPESPEIVSVEEGGYAVQKNGGNPESRPDSPKCHAEQNHLLIEGPSGTVS
LPFSLKANRPPLEVLKKIFPNQKPTVLELILKGCGGDLVSAVEVLLSSRSSVTGAERTSA
EPESLALPSNGHIFEHTLSSYPISSSKWSVGSAFRVPDTLRFSADSSNVVPSPLAGPLQP
PFPQPPRYPLMLRNTLARSQSSPFLPNDVTLWNTMTLQQQYQLRSQYVSPFPSNSTSVFR
SSPVLPARATEDPRISIPDDGCPFVSKQSIYTEDDYDERSDSSDSRTLNTSS
Function
Probable transcription factor that plays a role in configuring the spinal circuits controlling stride in vertebrates. Involved in neuronal specification within specific subdivision of spinal cord neurons and in the development of a coordinated locomotor network controlling limb movements. May regulate transcription during sexual development.
Tissue Specificity Expressed in testis.

Molecular Interaction Atlas (MIA) of This DOT

9 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
46,XY partial gonadal dysgenesis DISMNH0C Strong Genetic Variation [1]
Adult germ cell tumor DISJUCQ7 Strong Altered Expression [2]
Cerebral palsy DIS82ODL Strong Biomarker [3]
Germ cell tumor DIS62070 Strong Altered Expression [2]
Germ cell tumour DISOF3TK Strong Altered Expression [2]
Hepatocellular carcinoma DIS0J828 Strong Biomarker [4]
Spastic cerebral palsy DISORE14 Strong Biomarker [3]
Lung squamous cell carcinoma DISXPIBD moderate Biomarker [5]
Nervous system disease DISJ7GGT Limited Biomarker [6]
------------------------------------------------------------------------------------
⏷ Show the Full List of 9 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
3 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Doublesex- and mab-3-related transcription factor 3 (DMRT3). [7]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Doublesex- and mab-3-related transcription factor 3 (DMRT3). [9]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the methylation of Doublesex- and mab-3-related transcription factor 3 (DMRT3). [10]
------------------------------------------------------------------------------------
2 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
SNDX-275 DMH7W9X Phase 3 SNDX-275 decreases the expression of Doublesex- and mab-3-related transcription factor 3 (DMRT3). [8]
Trichostatin A DM9C8NX Investigative Trichostatin A decreases the expression of Doublesex- and mab-3-related transcription factor 3 (DMRT3). [11]
------------------------------------------------------------------------------------

References

1 Association of deletion 9p, 46,XY gonadal dysgenesis and autistic spectrum disorder.Mol Hum Reprod. 2007 Sep;13(9):685-9. doi: 10.1093/molehr/gam045. Epub 2007 Jul 20.
2 Identification of a TSPY co-expression network associated with DNA hypomethylation and tumor gene expression in somatic cancers.J Genet Genomics. 2016 Oct 20;43(10):577-585. doi: 10.1016/j.jgg.2016.09.003. Epub 2016 Sep 17.
3 Identification of a candidate enhancer for DMRT3 involved in spastic cerebral palsy pathogenesis.Biochem Biophys Res Commun. 2018 Jan 29;496(1):133-139. doi: 10.1016/j.bbrc.2018.01.011. Epub 2018 Jan 3.
4 Hypermethylation of ACP1, BMP4, and TSPYL5 in Hepatocellular Carcinoma and Their Potential Clinical Significance.Dig Dis Sci. 2016 Jan;61(1):149-57. doi: 10.1007/s10620-015-3878-3. Epub 2015 Sep 19.
5 Landscape of transcriptional deregulation in lung cancer.BMC Genomics. 2018 Jun 5;19(1):435. doi: 10.1186/s12864-018-4828-1.
6 Ma1, a novel neuron- and testis-specific protein, is recognized by the serum of patients with paraneoplastic neurological disorders.Brain. 1999 Jan;122 ( Pt 1):27-39. doi: 10.1093/brain/122.1.27.
7 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
8 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
9 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
10 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
11 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.