Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTOC70IF)

• DOT Name: Transmembrane protein 52B (TMEM52B)
• Gene Name: TMEM52B
• Related Disease:
  Gastric cancer
  Stomach cancer
  Advanced cancer
  Clear cell renal carcinoma
  Metastatic malignant neoplasm
  Renal cell carcinoma
• UniProt ID: TM52B_HUMAN
• Pfam ID: PF14979
• Sequence:
  MGVRVHVVAASALLYFILLSGTRCEENCGNPEHCLTTDWVHLWYIWLLVVIGALLLLCGL
  TSLCFRCCCLSRQQNGEDGGPPPCEVTVIAFDHDSTLQSTITSLQSVFGPAARRILAVAH
  SHSSLGQLPSSLDTLPGYEEALHMSRFTVAMCGQKAPDLPPVPEEKQLPPTEKESTRIVD
  SWN

Molecular Interaction Atlas (MIA) of This DOT

6 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Gastric cancer	DISXGOUK	Strong	Biomarker	[1]
Stomach cancer	DISKIJSX	Strong	Biomarker	[1]
Advanced cancer	DISAT1Z9	moderate	Altered Expression	[2]
Clear cell renal carcinoma	DISBXRFJ	moderate	Altered Expression	[2]
Metastatic malignant neoplasm	DIS86UK6	moderate	Altered Expression	[2]
Renal cell carcinoma	DISQZ2X8	moderate	Altered Expression	[2]

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Transmembrane protein 52B (TMEM52B).	[3]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Transmembrane protein 52B (TMEM52B).	[4]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Transmembrane protein 52B (TMEM52B).	[5]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of Transmembrane protein 52B (TMEM52B).	[6]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Transmembrane protein 52B (TMEM52B).	[7]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Transmembrane protein 52B (TMEM52B).	[8]

References

• [1] A positive feedback loop consisting of C12orf59/NF-B/CDH11 promotes gastric cancer invasion and metastasis.J Exp Clin Cancer Res. 2019 Apr 15;38(1):164. doi: 10.1186/s13046-019-1114-2.
• [2] Down-regulation of C12orf59 is associated with a poor prognosis and VHL mutations in renal cell carcinoma.Oncotarget. 2016 Feb 9;7(6):6824-34. doi: 10.18632/oncotarget.6829.
• [3] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [4] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [5] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [6] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [7] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [8] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.