Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTOF0GTU)

• DOT Name: Methyltransferase-like protein 27 (METTL27)
• Synonyms: Williams-Beuren syndrome chromosomal region 27 protein
• Gene Name: METTL27
• UniProt ID: MET27_HUMAN
• Pfam ID: PF13649
• Sequence:
  MAQEEGGSLPEVRARVRAAHGIPDLAQKLHFYDRWAPDYDQDVATLLYRAPRLAVDCLTQ
  ALPGPPHSALILDVACGTGLVAAELRAPGFLQLHGVDGSPGMLEQAQAPGLYQRLSLCTL
  GQEPLPSPEGTFDAVLIVGALSDGQVPCNAIPELHVTKPGGLVCLTTRTNSSNLQYKEAL
  EATLDRLEQAGMWEGLVAWPVDRLWTAGSWLPPSWRWYPASLPRMASSPALSTCTESGRR
  PRLRK

Molecular Interaction Atlas (MIA) of This DOT

9 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Methyltransferase-like protein 27 (METTL27).	[1]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Methyltransferase-like protein 27 (METTL27).	[2]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Methyltransferase-like protein 27 (METTL27).	[3]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Methyltransferase-like protein 27 (METTL27).	[4]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Methyltransferase-like protein 27 (METTL27).	[5]
Bortezomib	DMNO38U	Approved	Bortezomib decreases the expression of Methyltransferase-like protein 27 (METTL27).	[6]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Methyltransferase-like protein 27 (METTL27).	[7]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Methyltransferase-like protein 27 (METTL27).	[8]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Methyltransferase-like protein 27 (METTL27).	[9]

References

• [1] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [2] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [3] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [4] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [5] Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
• [6] The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
• [7] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [8] Inter- and intra-laboratory study to determine the reproducibility of toxicogenomics datasets. Toxicology. 2011 Nov 28;290(1):50-8.
• [9] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.