Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTP0QSL3)

• DOT Name: Factor associated with metabolism and energy (CCDC198)
• Synonyms: Protein CCDC198
• Gene Name: CCDC198
• UniProt ID: FAME_HUMAN
• Pfam ID: PF15398
• Sequence:
  MGLSHSKTHLRVIKVAPLQNKEVETPSAGRVDFAFNQNLEEKTSYSLARLQDQNKALEGQ
  LPPLQENWYGRYSTASRDMYFDIPLEHRETSIIKRHPPQRLQKLEPIDLPRVITSGRLLS
  QREARTMHKAKQVLEKKMQTPMYTSENRQYLHKMQVLEMIRKRQEAQMELKKSLHGEARI
  NKQSPRDHKAKKTLQSTPRNDDHDLLTMLPDEILNRGPGNSKNTEFLKHQAVNNYCPWKI
  GKMETWLHEQEAQGQLLWDSSSSDSDEQGKDEKKPRALVRTRTERIPLFDEFFDQE
• Function: May be involved in tuning the metabolism, energy expenditure, and excretion processes.

Molecular Interaction Atlas (MIA) of This DOT

7 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Factor associated with metabolism and energy (CCDC198).	[1]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Factor associated with metabolism and energy (CCDC198).	[2]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Factor associated with metabolism and energy (CCDC198).	[3]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Factor associated with metabolism and energy (CCDC198).	[4]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Factor associated with metabolism and energy (CCDC198).	[1]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Factor associated with metabolism and energy (CCDC198).	[5]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Factor associated with metabolism and energy (CCDC198).	[6]

References

• [1] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [2] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [3] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [4] Arsenic suppresses gene expression in promyelocytic leukemia cells partly through Sp1 oxidation. Blood. 2005 Jul 1;106(1):304-10.
• [5] CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
• [6] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.