Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTPPNZUA)

DOT Name	Septin-10 (SEPTIN10)
Gene Name	SEPTIN10
Related Disease	Advanced cancer ( ) Carcinoma ( ) Cerebral palsy ( ) Isolated cleft palate ( ) Neoplasm ( )
UniProt ID	SEP10_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF00735
Sequence	MASSEVARHLLFQSHMATKTTCMSSQGSDDEQIKRENIRSLTMSGHVGFESLPDQLVNRS IQQGFCFNILCVGETGIGKSTLIDTLFNTNFEDYESSHFCPNVKLKAQTYELQESNVQLK LTIVNTVGFGDQINKEESYQPIVDYIDAQFEAYLQEELKIKRSLFTYHDSRIHVCLYFIS PTGHSLKTLDLLTMKNLDSKVNIIPVIAKADTVSKTELQKFKIKLMSELVSNGVQIYQFP TDDDTIAKVNAAMNGQLPFAVVGSMDEVKVGNKMVKARQYPWGVVQVENENHCDFVKLRE MLICTNMEDLREQTHTRHYELYRRCKLEEMGFTDVGPENKPVSVQETYEAKRHEFHGERQ RKEEEMKQMFVQRVKEKEAILKEAERELQAKFEHLKRLHQEERMKLEEKRRLLEEEIIAF SKKKATSEIFHSQSFLATGSNLRKDKDRKNSNFL
Function	Filament-forming cytoskeletal GTPase. May play a role in cytokinesis (Potential).
Tissue Specificity	Widely expressed. Abundantly expressed in heart and kidney, placenta, skeletal muscles, liver and lung, as well as various tumor cell lines.

Molecular Interaction Atlas (MIA) of This DOT

5 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Advanced cancer	DISAT1Z9	Strong	Altered Expression	[1]
Carcinoma	DISH9F1N	Strong	Biomarker	[2]
Cerebral palsy	DIS82ODL	Strong	Biomarker	[3]
Isolated cleft palate	DISV80CD	Strong	Biomarker	[3]
Neoplasm	DISZKGEW	Strong	Altered Expression	[2]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Septin-10 (SEPTIN10).	[4]
------------------------------------------------------------------------------------

6 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Septin-10 (SEPTIN10).	[5]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Septin-10 (SEPTIN10).	[6]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Septin-10 (SEPTIN10).	[7]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Septin-10 (SEPTIN10).	[8]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Septin-10 (SEPTIN10).	[9]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Septin-10 (SEPTIN10).	[10]
------------------------------------------------------------------------------------


⏷ Show the Full List of 6 Drug(s)

References

1	Linking the septin expression with carcinogenesis.Mol Biol Rep. 2010 Oct;37(7):3601-8. doi: 10.1007/s11033-010-0009-2. Epub 2010 Feb 27.
2	Identification of a novel role of Septin 10 in paclitaxel-resistance in cancers through a functional genomics screen.Cancer Sci. 2012 Apr;103(4):821-7. doi: 10.1111/j.1349-7006.2012.02221.x. Epub 2012 Mar 4.
3	Long-term molecular and cytogenetic response and survival outcomes with imatinib 400 mg, imatinib 800 mg, dasatinib, and nilotinib in patients with chronic-phase chronic myeloid leukaemia: retrospective analysis of patient data from five clinical trials.Lancet Haematol. 2015 Mar;2(3):e118-28. doi: 10.1016/S2352-3026(15)00021-6. Epub 2015 Mar 20.
4	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
5	Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
6	Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
7	Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
8	Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
9	Environmental pollutant induced cellular injury is reflected in exosomes from placental explants. Placenta. 2020 Jan 1;89:42-49. doi: 10.1016/j.placenta.2019.10.008. Epub 2019 Oct 17.
10	A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.