Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTPU9OQP)

• DOT Name: Aspartate beta-hydroxylase domain-containing protein 1 (ASPHD1)
• Synonyms: EC 1.14.11.-
• Gene Name: ASPHD1
• UniProt ID: ASPH1_HUMAN
• EC Number: 1.14.11.-
• Pfam ID: PF05118
• Sequence:
  MKEGRGSFSVERGPRKERETAQSGMWKGNSPAGSQGAAMEGTGGELGGQGNWGPEDAPGL
  LARASLIMLPWPLPLASSALTLLFGALTSLFLWYCYRLGSQDMQALGAGSRAGGVRGGPV
  GCSEAGGPSPGGPGDPGEGPRTEGLVSRRLRAYARRYSWAGMGRVRRAAQGGPGPGRGPG
  VLGIQRPGLLFLPDLPSAPFVPRDAQRHDVELLESSFPAILRDFGAVSWDFSGTTPPPRG
  WSPPLAPGCYQLLLYQAGRCQPSNCRRCPGAYRALRGLRSFMSANTFGNAGFSVLLPGAR
  LEGRCGPTNARVRCHLGLKIPPGCELVVGGEPQCWAEGHCLLVDDSFLHTVAHNGSPEDG
  PRVVFIVDLWHPNVAGAERQALDFVFAPDP

Molecular Interaction Atlas (MIA) of This DOT

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Aspartate beta-hydroxylase domain-containing protein 1 (ASPHD1).	[1]
Arsenic	DMTL2Y1	Approved	Arsenic increases the methylation of Aspartate beta-hydroxylase domain-containing protein 1 (ASPHD1).	[5]

7 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Aspartate beta-hydroxylase domain-containing protein 1 (ASPHD1).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Aspartate beta-hydroxylase domain-containing protein 1 (ASPHD1).	[3]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Aspartate beta-hydroxylase domain-containing protein 1 (ASPHD1).	[4]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Aspartate beta-hydroxylase domain-containing protein 1 (ASPHD1).	[6]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Aspartate beta-hydroxylase domain-containing protein 1 (ASPHD1).	[7]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Aspartate beta-hydroxylase domain-containing protein 1 (ASPHD1).	[8]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Aspartate beta-hydroxylase domain-containing protein 1 (ASPHD1).	[9]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [3] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [4] Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
• [5] Epigenetic changes in individuals with arsenicosis. Chem Res Toxicol. 2011 Feb 18;24(2):165-7. doi: 10.1021/tx1004419. Epub 2011 Feb 4.
• [6] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [7] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [8] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [9] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.