Details of Drug Off-Target (DOT)
General Information of Drug Off-Target (DOT) (ID: OTQP9BWM)
| DOT Name | SERTA domain-containing protein 3 (SERTAD3) | ||||
|---|---|---|---|---|---|
| Synonyms | Replication protein-binding trans-activator; RPA-binding trans-activator | ||||
| Gene Name | SERTAD3 | ||||
| Related Disease | |||||
| UniProt ID | |||||
| 3D Structure | |||||
| Pfam ID | |||||
| Sequence |
MVGGLKRKHSDLEEEEERWEWSPAGLQSYQQALLRISLDKVQRSLGPRAPSLRRHVLIHN
TLQQLQAALRLAPAPALPPEPLFLGEEDFSLSATIGSILRELDTSMDGTEPPQNPVTPLG LQNEVPPQPDPVFLEALSSRYLGDSGLDDFFLDIDTSAVEKEPARAPPEPPHNLFCAPGS WEWNELDHIMEIILGS |
||||
| Function |
Antiviral interferon-stimulated protein that plays a role in innate immunity and in the suppression of viruses through different mechanisms. Plays a role in the late phase response of TLR-induced immune effector expression. During influenza infection, interacts with PB2, PB1, and PA to disrupt the formation of the viral RdRp complex. Inhibits zika virus by interacting with the capsid protein in the nucleolus and reducing its abundance through proteasomal degradation. Strong transcriptional coactivator.
|
||||
Molecular Interaction Atlas (MIA) of This DOT
|
1 Disease(s) Related to This DOT
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Molecular Interaction Atlas (MIA) | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
8 Drug(s) Affected the Gene/Protein Processing of This DOT
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
1 Drug(s) Affected the Post-Translational Modifications of This DOT
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
