Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTSQWC36)

• DOT Name: Butyrophilin subfamily 1 member A1 (BTN1A1)
• Synonyms: BT
• Gene Name: BTN1A1
• Related Disease:
  Nervous system disease
  Schizophrenia
  Temporal lobe epilepsy
  Hepatitis C virus infection
  Lysosomal storage disease
  Rheumatoid arthritis
• UniProt ID: BT1A1_HUMAN
• Pfam ID: PF08205 ; PF13765 ; PF00622 ; PF07686
• Sequence:
  MAVFPSSGLPRCLLTLILLQLPKLDSAPFDVIGPPEPILAVVGEDAELPCRLSPNASAEH
  LELRWFRKKVSPAVLVHRDGREQEAEQMPEYRGRATLVQDGIAKGRVALRIRGVRVSDDG
  EYTCFFREDGSYEEALVHLKVAALGSDPHISMQVQENGEICLECTSVGWYPEPQVQWRTS
  KGEKFPSTSESRNPDEEGLFTVAASVIIRDTSAKNVSCYIQNLLLGQEKKVEISIPASSL
  PRLTPWIVAVAVILMVLGLLTIGSIFFTWRLYNERPRERRNEFSSKERLLEELKWKKATL
  HAVDVTLDPDTAHPHLFLYEDSKSVRLEDSRQKLPEKTERFDSWPCVLGRETFTSGRHYW
  EVEVGDRTDWAIGVCRENVMKKGFDPMTPENGFWAVELYGNGYWALTPLRTPLPLAGPPR
  RVGIFLDYESGDISFYNMNDGSDIYTFSNVTFSGPLRPFFCLWSSGKKPLTICPIADGPE
  RVTVIANAQDLSKEIPLSPMGEDSAPRDADTLHSKLIPTQPSQGAP
• Function: May function in the secretion of milk-fat droplets. May act as a specific membrane-associated receptor for the association of cytoplasmic droplets with the apical plasma membrane. Inhibits the proliferation of CD4 and CD8 T-cells activated by anti-CD3 antibodies, T-cell metabolism and IL2 and IFNG secretion.
• Reactome Pathway: Butyrophilin (BTN) family interactions (R-HSA-8851680)

Molecular Interaction Atlas (MIA) of This DOT

6 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Nervous system disease	DISJ7GGT	Definitive	Biomarker	[1]
Schizophrenia	DISSRV2N	Definitive	Biomarker	[1]
Temporal lobe epilepsy	DISNOPXX	Definitive	Biomarker	[1]
Hepatitis C virus infection	DISQ0M8R	Strong	Genetic Variation	[2]
Lysosomal storage disease	DIS6QM6U	Limited	Biomarker	[3]
Rheumatoid arthritis	DISTSB4J	Limited	Biomarker	[4]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Butyrophilin subfamily 1 member A1 (BTN1A1).	[5]

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Butyrophilin subfamily 1 member A1 (BTN1A1).	[6]

References

• [1] Off-Label Use of Bumetanide for Brain Disorders: An Overview.Front Neurosci. 2019 Apr 24;13:310. doi: 10.3389/fnins.2019.00310. eCollection 2019.
• [2] Fine-mapping butyrophilin family genes revealed several polymorphisms influencing viral genotype selection in hepatitis C infection.Genes Immun. 2015 Jul-Aug;16(5):297-300. doi: 10.1038/gene.2015.14. Epub 2015 Apr 30.
• [3] The yeast model for Batten disease: a role for Btn2p in the trafficking of the Golgi-associated vesicular targeting protein, Yif1p.Biochem Biophys Res Commun. 2003 Mar 14;302(3):534-8. doi: 10.1016/s0006-291x(03)00209-2.
• [4] HLA-DPB1-COL11A2 and three additional xMHC loci are independently associated with RA in a UK cohort.Genes Immun. 2011 Apr;12(3):169-75. doi: 10.1038/gene.2010.57. Epub 2011 Feb 3.
• [5] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [6] CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.