Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTSWJOWL)

• DOT Name: Sperm acrosome membrane-associated protein 6 (SPACA6)
• Synonyms: BACHELOR-like protein
• Gene Name: SPACA6
• UniProt ID: SACA6_HUMAN
• PDB ID: 7TA2
• Sequence:
  MALLALASAVPSALLALAVFRVPAWACLLCFTTYSERLRICQMFVGMRSPKLEECEEAFT
  AAFQGLSDTEINYDERSHLHDTFTQMTHALQELAAAQGSFEVAFPDAAEKMKKVITQLKE
  AQACIPPCGLQEFARRFLCSGCYSRVCDLPLDCPVQDVTVTRGDQAMFSCIVNFQLPKEE
  ITYSWKFAGGGLRTQDLSYFRDMPRAEGYLARIRPAQLTHRGTFSCVIKQDQRPLARLYF
  FLNVTGPPPRAETELQASFREVLRWAPRDAELIEPWRPSLGELLARPEALTPSNLFLLAV
  LGALASASATVLAWMFFRWYCSGN
• Function: Sperm protein required for fusion of sperm with the egg membrane during fertilization.
• Tissue Specificity: Detected at the sperm head, equatorial region, neck and midpiece (at protein level) . Expressed in testis .

Molecular Interaction Atlas (MIA) of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Sperm acrosome membrane-associated protein 6 (SPACA6).	[1]

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Sperm acrosome membrane-associated protein 6 (SPACA6).	[2]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Sperm acrosome membrane-associated protein 6 (SPACA6).	[3]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Sperm acrosome membrane-associated protein 6 (SPACA6).	[4]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Sperm acrosome membrane-associated protein 6 (SPACA6).	[5]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Sperm acrosome membrane-associated protein 6 (SPACA6).	[6]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of Sperm acrosome membrane-associated protein 6 (SPACA6).	[7]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of Sperm acrosome membrane-associated protein 6 (SPACA6).	[8]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde decreases the expression of Sperm acrosome membrane-associated protein 6 (SPACA6).	[9]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [3] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [4] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [5] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [6] Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.
• [7] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [8] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
• [9] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.