Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTT1TXO8)

DOT Name Coiled-coil domain-containing protein 138 (CCDC138)
Gene Name CCDC138
UniProt ID
CC138_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF21035 ; PF21037
Sequence
MEPRVVKPPGQDLVVESLKSRYGLGGSCPDEYDFSNFYQSKYKRRTLTSPGDLDIYSGDK
VGSSLKYSDESKHCRTPLGSLFKHVNVNCLDDELDSFHDLKKQETEEELIENDYRVSTSK
ITKQSFKEIEKVALPTNTTSSRPRTECCSDAGDSPLKPVSCPKSKASDKRSLLPHQISQI
YDELFQIHLKLQCETAAQQKFAEELQKRERFLLEREQLLFRHENALSKIKGVEEEVLTRF
QIIKEQHDAEVEHLTEVLKEKNKETKRLRSSFDALKELNDTLKKQLNEASEENRKIDIQA
KRVQARLDNLQRKYEFMTIQRLKGSSHAVHEMKSLKQEKAPVSKTYKVPLNGQVYELLTV
FMDWISDHHLSKVKHEESGMDGKKPQLKFASQRNDIQEKCVKLLPLMTEQLQWMPFVNIK
LHEPFVKFIYWSLRQLDAGAQHSTMTSTLRRLGEDIFKGVVTKGIQDNSPQHSVENKPKT
AAFFKSSNLPLRFLSTLIVLKTVTQADYLAQAFDSLCLDLKTEEGKTLFLEYQAVPVILS
HLRISSKGLLSNVIDSLLQMTVESKSLQPFLEACSNSLFFRTCSVLLRAPKLDLQILEKL
SIILQKLSKIKSNKKLFELFTIHLMLQEIQRTTNPEHAFLCINLNSTLFNLGLTKCNSLV
SSASP

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
13 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Coiled-coil domain-containing protein 138 (CCDC138). [1]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Coiled-coil domain-containing protein 138 (CCDC138). [2]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Coiled-coil domain-containing protein 138 (CCDC138). [3]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Coiled-coil domain-containing protein 138 (CCDC138). [4]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of Coiled-coil domain-containing protein 138 (CCDC138). [5]
Quercetin DM3NC4M Approved Quercetin decreases the expression of Coiled-coil domain-containing protein 138 (CCDC138). [2]
Calcitriol DM8ZVJ7 Approved Calcitriol decreases the expression of Coiled-coil domain-containing protein 138 (CCDC138). [6]
Testosterone DM7HUNW Approved Testosterone decreases the expression of Coiled-coil domain-containing protein 138 (CCDC138). [6]
Zoledronate DMIXC7G Approved Zoledronate increases the expression of Coiled-coil domain-containing protein 138 (CCDC138). [7]
Azathioprine DMMZSXQ Approved Azathioprine decreases the expression of Coiled-coil domain-containing protein 138 (CCDC138). [8]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the expression of Coiled-coil domain-containing protein 138 (CCDC138). [9]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 decreases the expression of Coiled-coil domain-containing protein 138 (CCDC138). [10]
Formaldehyde DM7Q6M0 Investigative Formaldehyde decreases the expression of Coiled-coil domain-containing protein 138 (CCDC138). [12]
------------------------------------------------------------------------------------
⏷ Show the Full List of 13 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 decreases the phosphorylation of Coiled-coil domain-containing protein 138 (CCDC138). [11]
------------------------------------------------------------------------------------

References

1 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
2 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
3 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
4 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
5 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
6 Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
7 The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
8 A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
9 Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
10 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
11 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
12 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.