General Information of Drug Off-Target (DOT) (ID: OTT52V2I)

DOT Name Cytochrome c oxidase assembly factor 6 homolog (COA6)
Gene Name COA6
Related Disease
Hypertrophic cardiomyopathy ( )
Cardioencephalomyopathy, fatal infantile, due to cytochrome c oxidase deficiency 4 ( )
Cardiomyopathy ( )
Cerebellar ataxia ( )
Cytochrome-c oxidase deficiency disease ( )
Dystonia ( )
Progressive pseudorheumatoid arthropathy of childhood ( )
UniProt ID
COA6_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
6NL3; 6PCE; 6PCF
Pfam ID
PF02297
Sequence
MGPGGPLLSPSRGFLLCKTGWHSNRLLGDCGPHTPVSTALSFIAVGMAAPSMKERQVCWG
ARDEYWKCLDENLEDASQCKKLRSSFESSCPQQWIKYFDKRRDYLKFKEKFEAGQFEPSE
TTAKS
Function
Involved in the maturation of the mitochondrial respiratory chain complex IV subunit MT-CO2/COX2. Thereby, may regulate early steps of complex IV assembly. Mitochondrial respiratory chain complex IV or cytochrome c oxidase is the component of the respiratory chain that catalyzes the transfer of electrons from intermembrane space cytochrome c to molecular oxygen in the matrix and as a consequence contributes to the proton gradient involved in mitochondrial ATP synthesis. May also be required for efficient formation of respiratory supercomplexes comprised of complexes III and IV.
KEGG Pathway
Thermogenesis (hsa04714 )
Reactome Pathway
Mitochondrial protein import (R-HSA-1268020 )

Molecular Interaction Atlas (MIA) of This DOT

7 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Hypertrophic cardiomyopathy DISQG2AI Definitive Genetic Variation [1]
Cardioencephalomyopathy, fatal infantile, due to cytochrome c oxidase deficiency 4 DISXJWBI Strong Unknown [2]
Cardiomyopathy DISUPZRG Strong Biomarker [3]
Cerebellar ataxia DIS9IRAV Strong Biomarker [4]
Cytochrome-c oxidase deficiency disease DISK7N3G Strong Genetic Variation [1]
Dystonia DISJLFGW Strong Biomarker [4]
Progressive pseudorheumatoid arthropathy of childhood DISBMRIW Strong Altered Expression [5]
------------------------------------------------------------------------------------
⏷ Show the Full List of 7 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of Cytochrome c oxidase assembly factor 6 homolog (COA6). [6]
------------------------------------------------------------------------------------
8 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Cytochrome c oxidase assembly factor 6 homolog (COA6). [7]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of Cytochrome c oxidase assembly factor 6 homolog (COA6). [8]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of Cytochrome c oxidase assembly factor 6 homolog (COA6). [9]
Epigallocatechin gallate DMCGWBJ Phase 3 Epigallocatechin gallate decreases the expression of Cytochrome c oxidase assembly factor 6 homolog (COA6). [10]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Cytochrome c oxidase assembly factor 6 homolog (COA6). [11]
Milchsaure DM462BT Investigative Milchsaure decreases the expression of Cytochrome c oxidase assembly factor 6 homolog (COA6). [12]
Sulforaphane DMQY3L0 Investigative Sulforaphane increases the expression of Cytochrome c oxidase assembly factor 6 homolog (COA6). [13]
Deguelin DMXT7WG Investigative Deguelin increases the expression of Cytochrome c oxidase assembly factor 6 homolog (COA6). [14]
------------------------------------------------------------------------------------
⏷ Show the Full List of 8 Drug(s)

References

1 Mutations in COA6 cause cytochrome c oxidase deficiency and neonatal hypertrophic cardiomyopathy.Hum Mutat. 2015 Jan;36(1):34-8. doi: 10.1002/humu.22715. Epub 2014 Nov 18.
2 Molecular diagnosis of infantile mitochondrial disease with targeted next-generation sequencing. Sci Transl Med. 2012 Jan 25;4(118):118ra10. doi: 10.1126/scitranslmed.3003310.
3 Cooperation between COA6 and SCO2 in COX2 maturation during cytochrome c oxidase assembly links two mitochondrial cardiomyopathies.Cell Metab. 2015 Jun 2;21(6):823-33. doi: 10.1016/j.cmet.2015.04.012. Epub 2015 May 7.
4 Human mitochondrial cytochrome c oxidase assembly factor COX18 acts transiently as a membrane insertase within the subunit 2 maturation module.J Biol Chem. 2017 May 12;292(19):7774-7783. doi: 10.1074/jbc.M117.778514. Epub 2017 Mar 22.
5 RNAi inhibition of feruloyl CoA 6'-hydroxylase reduces scopoletin biosynthesis and post-harvest physiological deterioration in cassava (Manihot esculenta Crantz) storage roots.Plant Mol Biol. 2017 May;94(1-2):185-195. doi: 10.1007/s11103-017-0602-z. Epub 2017 Mar 18.
6 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
7 Increased mitochondrial ROS formation by acetaminophen in human hepatic cells is associated with gene expression changes suggesting disruption of the mitochondrial electron transport chain. Toxicol Lett. 2015 Apr 16;234(2):139-50.
8 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
9 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
10 Epigallocatechin-3-gallate (EGCG) protects against chromate-induced toxicity in vitro. Toxicol Appl Pharmacol. 2012 Jan 15;258(2):166-75.
11 Targeting MYCN in neuroblastoma by BET bromodomain inhibition. Cancer Discov. 2013 Mar;3(3):308-23.
12 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
13 Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
14 Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.