Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTTG945X)

• DOT Name: CMT1A duplicated region transcript 4 protein (CDRT4)
• Gene Name: CDRT4
• UniProt ID: CDRT4_HUMAN
• Pfam ID: PF15213
• Sequence:
  MDARRMKKEEGLTENTGLPRKLLEKHDPWPAYVTYTSQTVKRLIEKSKTRELECMRALEE
  RPWASRQNKPSSVIQPKRRKSSKSSGKAVFRDTLSESTLSMWGAYSVLAMAPTMIPEPTH
  LHADSRDCPTENYNKIIFARKPMMRMLPTVRY
• Tissue Specificity: Expressed in fetal skeletal muscle and kidney.

Molecular Interaction Atlas (MIA) of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of CMT1A duplicated region transcript 4 protein (CDRT4).	[1]

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of CMT1A duplicated region transcript 4 protein (CDRT4).	[2]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of CMT1A duplicated region transcript 4 protein (CDRT4).	[3]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of CMT1A duplicated region transcript 4 protein (CDRT4).	[4]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of CMT1A duplicated region transcript 4 protein (CDRT4).	[5]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of CMT1A duplicated region transcript 4 protein (CDRT4).	[6]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of CMT1A duplicated region transcript 4 protein (CDRT4).	[7]
Testosterone	DM7HUNW	Approved	Testosterone increases the expression of CMT1A duplicated region transcript 4 protein (CDRT4).	[7]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of CMT1A duplicated region transcript 4 protein (CDRT4).	[8]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [3] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [4] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [5] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [6] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [7] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [8] Characterization of the Molecular Alterations Induced by the Prolonged Exposure of Normal Colon Mucosa and Colon Cancer Cells to Low-Dose Bisphenol A. Int J Mol Sci. 2022 Oct 1;23(19):11620. doi: 10.3390/ijms231911620.